SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010967 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010967
Domain Number 1 Region: 1-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.89e-24
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 161-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.25e-23
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 203-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 123-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.24e-16
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010967   Gene: ENSPPYG00000009792   Transcript: ENSPPYT00000011396
Sequence length 256
Comment pep:novel chromosome:PPYG2:19:22523270:22533057:-1 gene:ENSPPYG00000009792 transcript:ENSPPYT00000011396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGSLTFRDVTIEFSLEEWQCLDTAQQNLYRDVMLENYRNMVFLGITVSKLDLITCLKQGK
EPWNMKRHEMVTKPSVISSHFTQDWPDQSIKDSFQEVILRTYARCGHKNLRLRKDCESVN
EDKPYKYKKCGKAFNFSSMFTKHKIIHTGKKPCKCEECGKVFNNSSTLMKHKIIHTGKKL
YKCEECGKAFKQSSHFTRHKAVHTGEKPYKCEECGKAFNHFSALRKHQIIHTGKQPYKCE
ECGKAFSNFSALRKHE
Download sequence
Identical sequences H2NY88
ENSPPYP00000010967 9600.ENSPPYP00000010967 ENSPPYP00000010967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]