SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010975 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010975
Domain Number 1 Region: 292-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 460-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.13e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.63e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 404-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.67e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.32e-23
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 6 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 506-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.8e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 8 Region: 180-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000216
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 9 Region: 142-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000856
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010975   Gene: ENSPPYG00000009800   Transcript: ENSPPYT00000011404
Sequence length 568
Comment pep:known_by_projection chromosome:PPYG2:19:23761508:23795427:-1 gene:ENSPPYG00000009800 transcript:ENSPPYT00000011404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLTFRDVAIEFSLEEWQCLDTAQRNLYKNVILENYRNLVFLGIAVSKQDLITCLEQEK
EPLTVKRHEMVDEPPVMCSHFAQEFWPEQNIKDSFEKVTLRRYEKCGNDNFQLKGCKSVD
ECKVHKGGYNGLNQCLPTTQSKMFQCDKYVKVFNKFSHSDRRKIKHVENKPFKCKECGKS
FCMLSHLTRHERNYTKVNFCKCEECEKAFNQSSKLTKHKRIYTCEKLYKCQECDRTFSQF
SNLTEYKKDYTREKPYKCEECGKAFNQSSHLTTHKIIHTGEKPYKCEECGKAFNQFSNLT
THKKIHTGEQPYICEECGKAFTQSSTLTTHKRIHTGEKPYKCEECGKAFNRSSKLTEHKN
IHTGEQPYKCEECGKAFNRSSNLTEHRKIHTEEKPYKCKECGKAFKHSSALTTHKRIHTG
EKPYICEECGKAFNRSSKLTEHKKLHTGKKPYKCEECGKAFIQSSKLTEHKKIHSGEIPY
KCEECGKAFKHSSSLTTHKRIHTGEKPYKCEECGKAFSRSSKLTEHKIIHTGEKPYKCER
CDKAFNQSANLTKHKKIHTGEKLQNWNV
Download sequence
Identical sequences H2NY96
ENSPPYP00000010975 ENSPPYP00000010975 XP_009251367.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]