SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000010981 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000010981
Domain Number 1 Region: 13-133
Classification Level Classification E-value
Superfamily PH domain-like 1.36e-28
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 2 Region: 148-219
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.97e-22
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000010981   Gene: ENSPPYG00000009806   Transcript: ENSPPYT00000011410
Sequence length 279
Comment pep:known_by_projection chromosome:PPYG2:19:30097649:30098488:1 gene:ENSPPYG00000009806 transcript:ENSPPYT00000011410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDHLANTEINSQRIAAVESCFGASGQPLALPGRVLLGEGVLTKECRKKAKPRIFFLFND
ILVYGSIVLNKRKYRSQHIIPLEEVTLELLPETLQAKNRWMIKTAKKSFVVSAASATERQ
EWISHIEECVRRQLRATGRPPSTEHAAPWIPDKATDICMRCTQTRFSALTRRHHCRKCGF
VVCAECSRQRFLLPRLSPKPVRVCSLCYRELASQQQQEEAEEQGAESPGQPAHLARPICG
ASSGDDDDSDEDKEGSRDGDWPSRVEFYASGVAWSAFHS
Download sequence
Identical sequences H2NYA1
9600.ENSPPYP00000010981 ENSPPYP00000010981 XP_003779171.1.23681 ENSPPYP00000010981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]