SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011012 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011012
Domain Number 1 Region: 4-554
Classification Level Classification E-value
Superfamily SIS domain 2.27e-233
Family Phosphoglucose isomerase, PGI 7.55e-16
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011012   Gene: ENSPPYG00000009835   Transcript: ENSPPYT00000011442
Sequence length 558
Comment pep:known chromosome:PPYG2:19:35031028:35068667:1 gene:ENSPPYG00000009835 transcript:ENSPPYT00000011442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALTRDPQFQKLQQWYREHGSELNLRRLFDANKDRFNHFSLTLNTNHGHILVDYSKNLV
TEDVMRMLVDLAKSRGVEAARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMP
EVNKVLDKMKSFCQRVRSGDWKGYTGKTITDIINIGIGGSDLGPLMVTEALKPYSSGGPR
VWYVSNIDGTHIAKTLAQLNPESSVFIIASKTFTTQETITNAETAKEWFLQTAKDPSAVA
KHFVALSTNTTKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGA
HWMDQHFRTTPLEKNAPVLLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESN
GKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGL
HHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPEDLERLLPHKVFEGNRPTNSIVFT
KLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDA
STNGLINFIKQQREARIQ
Download sequence
Identical sequences H2NYD1
ENSPPYP00000011012 9600.ENSPPYP00000011012 ENSPPYP00000011012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]