SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011022 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011022
Domain Number 1 Region: 263-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 403-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.42e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 515-572
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.65e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 4 Region: 1-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-23
Family KRAB domain (Kruppel-associated box) 0.00083
Further Details:      
 
Domain Number 5 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 459-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-20
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 211-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.71e-20
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 557-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.97e-20
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 9 Region: 152-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.32e-18
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 10 Region: 113-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000486
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 11 Region: 366-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000907
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011022   Gene: ENSPPYG00000009843   Transcript: ENSPPYT00000011452
Sequence length 618
Comment pep:known_by_projection chromosome:PPYG2:19:35666839:35686487:1 gene:ENSPPYG00000009843 transcript:ENSPPYT00000011452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHFQGSVTFEDVAIAFSQQEWESLDSSQRGLYRDVMLENYRNLVSMAGHSLSKPHVIAL
LEQWKEPEVTVRKDGRRWCTDLQLEDDTIGHKEMPTSENCPSFALHQKISRQKPCECREY
GKTLCQDSKPVQHERIHSSEKPNRCKECGKNFSNGHQLTIHQRLHVGEKPYKCEKCGKVF
ISGSAFVKHGRIHTGEKPLKHKQCGKTISGSYQLTVHKSIHTGKKPYECGECGKAFLVYG
KLTWHQSTHTGEKPFGCEECGKAFSTFSYLVQHQRIHTGEKPYECKECGKAFSTSSPLAK
HQRIHTGEKPYECKECGKAFTVYGQLTRHQSIHTGEKPFECKECGKAFRLSSFLHAHQRI
HAGIKPYGCKECGKTFSRASYLVQHGRLHTGEKLYECKECGKAFSTGSYLVQHQRIHTGE
KPYECKECGKAFISCHQLTVHQRVHTGEKPYECKECGKAFRVHVHLSQHRKIHTDVKCYE
CKECGKTFSRASYLVQHGRIHTGKKPYECKECGKAFSSGSYLIQHQRIHTGEKPYECNKC
GKAFTVYGQLIGHQSVHTGEKPFECKECGKAFRLNSFLTEHQQVHTGEKPFKCKKCGKTF
RYSSALKVHLRKHMSVIP
Download sequence
Identical sequences H2NYE1
ENSPPYP00000011022 ENSPPYP00000011022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]