SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011023 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011023
Domain Number 1 Region: 445-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 389-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.56e-24
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 3 Region: 277-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.14e-23
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 333-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 220-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-19
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 490-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.09e-19
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 7 Region: 88-133
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000227
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011023   Gene: ENSPPYG00000009844   Transcript: ENSPPYT00000011453
Sequence length 590
Comment pep:known_by_projection chromosome:PPYG2:19:35698330:35703509:-1 gene:ENSPPYG00000009844 transcript:ENSPPYT00000011453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLENFALIASLGLISFRSHIVSQLEMGKEPWVPDSVDMTSAMARGAYGRPGSDFCRGTEG
KDLPSEHNVSVEGVAQDRSPEATLCPQKTCPCDICGLRLKDILHLAEHQTTHPRQKPFVC
EAYVKASEFSANLPQKRVQQNVHNPIRREEGQASPVKTCGDYTSDQLSTCREGGKDFVAT
AGFLQHEITPSNGEPHKATEGVVDFHIALRHNKCCESRDAFNDKSTLVQHQRIHSRERPY
ECSKCGIFFSYAADLTQHQKVHNRGKPYECCECGKFFSQHSSLVKHRRVHTGESPHVCGD
CGKFFSRSSNLIQHKRVHTGEKPYECSDCGKFFSQRSNLIHHKRVHTGRSAHECSECGKS
FNCNSSLIKHWRVHTGERPYKCNECGKFFSHIASLIQHQIVHTGERPHGCGECGKAFSRS
SDLMKHQRVHTGERPYECNECGKLFSQSSSLNSHRRLHTGERPYQCSECGKFFNQSSSLN
NHRRLHTGERPYECSECGKTFRQRSNLRQHLKVHKPDRPYECSECGKAFNQRPTLIRHQK
IHTRERSMENVLLPCSQHTPEISSENRSYEGVVNYKLKLVYPSTHPGEFP
Download sequence
Identical sequences H2NYE2
ENSPPYP00000011023 ENSPPYP00000011023 XP_002829095.3.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]