SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011034 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011034
Domain Number 1 Region: 84-159
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.63e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0000637
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000011034
Domain Number - Region: 150-190
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0115
Family Leucine zipper domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011034   Gene: ENSPPYG00000009855   Transcript: ENSPPYT00000011465
Sequence length 203
Comment pep:known_by_projection chromosome:PPYG2:19:36042537:36052169:1 gene:ENSPPYG00000009855 transcript:ENSPPYT00000011465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTAVSVQTTDQSLQAGGQFYVMMTPQ
DVLQTGTQRTIAPRTHPYSPKIDGTRTPRDERRRAQHNEVERRRRDKINNWIVQLSKIIP
DCNADNSKTGASKGGILSKACDYIRELRQTNQRMQETFKEAERLQMDNELLRQQIEELKN
ENALLRAQLQQHNLEMVGEGTRQ
Download sequence
Identical sequences H2NYF3
9600.ENSPPYP00000011034 ENSPPYP00000011034 ENSPPYP00000011034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]