SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011061 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000011061
Domain Number - Region: 210-246
Classification Level Classification E-value
Superfamily HMG-box 0.0074
Family HMG-box 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011061   Gene: ENSPPYG00000009880   Transcript: ENSPPYT00000011493
Sequence length 246
Comment pep:known_by_projection chromosome:PPYG2:19:36560180:36566945:1 gene:ENSPPYG00000009880 transcript:ENSPPYT00000011493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPVKVKVEKSELEMAKARNQLDAVLQCLLEKSHMDRECLDEEAGKTPSDTHNKDCSIAA
TGKRPSARFPHQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR
AWMRNSPSVRERECSPSSPLPPLPEDEEGSEVTNSKSRDVYKLPPPTPPGPPGDACRSRI
PSPLQPEMQGTPDDEPSEPEPSPSTLIYRNMQRWKRIRQRWKEASHRNQLRYSESMKILR
EMYERQ
Download sequence
Identical sequences H2NYI0
ENSPPYP00000011061 ENSPPYP00000011061 ENSPPYP00000023940 9600.ENSPPYP00000011061 XP_002829127.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]