SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011082 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011082
Domain Number 1 Region: 80-137
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 192-249
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.85e-26
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 136-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 42-94
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.89e-20
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 238-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-19
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 6 Region: 5-53
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011082   Gene: ENSPPYG00000009900   Transcript: ENSPPYT00000011514
Sequence length 292
Comment pep:known chromosome:PPYG2:19:37055003:37082927:1 gene:ENSPPYG00000009900 transcript:ENSPPYT00000011514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHLSQQRIYSGENPFACKVCGKVFSHKSNLTEHEHFHTREKPFECNECGKAFSQKQYVI
KHQNTHTGEKLFECNECGKSFSQKENLLTHQKIHTGEKPFECKDCGKAFIQKSNLIRHQR
THTGEKPFVCKECGKTFSGKSNLTEHEKIHIGEKPFKCSECGTAFGQKKYLIKHQNIHTG
EKPYECNECGKAFSQRTSLIVHVRIHSGDKPYECNVCGKAFSQSSSLTVHVRSHTGEKPY
GCNECGKAFSQFSTLALHLRIHTGKKPYQCSECGKAFSQKSHHIRHQKIHTH
Download sequence
Identical sequences A0A0A0MUE1 A0A2I3H3Q5 A0A2J8RS26 A0A2K5H9T3 A0A2K5UFG6 A0A2K5XAT7 A0A2K6B0M9 A0A2K6NJ09 G3QCU9 H2QG61 Q15072 Q5RFP4
ENSPPYP00000011082 ENSNLEP00000022627 NP_001093108.1.87134 NP_001093108.1.92137 NP_001093109.1.87134 NP_001093109.1.92137 NP_001124596.1.23681 NP_009076.2.87134 NP_009076.2.92137 XP_001163164.1.37143 XP_003259722.1.23891 XP_003316336.1.37143 XP_003316337.1.37143 XP_003816214.1.60992 XP_003816215.1.60992 XP_003816216.1.60992 XP_003816217.1.60992 XP_003816218.1.60992 XP_003816219.1.60992 XP_004060622.1.27298 XP_004060625.1.27298 XP_004060633.1.27298 XP_004089233.1.23891 XP_004089234.1.23891 XP_004089235.1.23891 XP_004089236.1.23891 XP_004089237.1.23891 XP_004089238.1.23891 XP_004089239.1.23891 XP_004089240.1.23891 XP_004089241.1.23891 XP_004089242.1.23891 XP_005259271.1.92137 XP_005589001.1.63531 XP_005589003.1.63531 XP_005589004.1.63531 XP_005589005.1.63531 XP_005589006.1.63531 XP_007994676.1.81039 XP_007994677.1.81039 XP_007994678.1.81039 XP_007994679.1.81039 XP_007994680.1.81039 XP_007994682.1.81039 XP_007994683.1.81039 XP_007994684.1.81039 XP_007994685.1.81039 XP_007994686.1.81039 XP_008967366.1.60992 XP_008967367.1.60992 XP_009433686.1.37143 XP_009433688.1.37143 XP_009433689.1.37143 XP_010367113.1.97406 XP_010367114.1.97406 XP_010367115.1.97406 XP_010367116.1.97406 XP_010367117.1.97406 XP_011763386.1.29376 XP_011763387.1.29376 XP_011763388.1.29376 XP_011763389.1.29376 XP_011763390.1.29376 XP_011763391.1.29376 XP_011763392.1.29376 XP_011763393.1.29376 XP_011763394.1.29376 XP_011763395.1.29376 XP_011763397.1.29376 XP_011763398.1.29376 XP_011763399.1.29376 XP_011763400.1.29376 XP_011804055.1.43180 XP_011804064.1.43180 XP_011804073.1.43180 XP_011804078.1.43180 XP_011804087.1.43180 XP_011804095.1.43180 XP_011804104.1.43180 XP_011804109.1.43180 XP_011804116.1.43180 XP_011804126.1.43180 XP_011804135.1.43180 XP_011840192.1.47321 XP_011840193.1.47321 XP_011840194.1.47321 XP_011840195.1.47321 XP_012355692.1.23891 XP_012355694.1.23891 XP_012355695.1.23891 XP_012355696.1.23891 XP_012355698.1.23891 XP_012355699.1.23891 XP_015297152.1.63531 XP_015297153.1.63531 XP_015297155.1.63531 XP_015297156.1.63531 XP_015297157.1.63531 XP_015297158.1.63531 XP_015297159.1.63531 XP_016791243.1.37143 XP_016791244.1.37143 XP_016791245.1.37143 XP_016882733.1.92137 XP_016882734.1.92137 XP_016882735.1.92137 XP_016882736.1.92137 XP_018871808.1.27298 XP_018871809.1.27298 XP_018871810.1.27298 XP_018871811.1.27298 XP_018871812.1.27298 9598.ENSPTRP00000018661 9600.ENSPPYP00000011082 9606.ENSP00000301233 ENSP00000392095 gi|153791570|ref|NP_001093109.1| gi|153791687|ref|NP_001093108.1| gi|153792188|ref|NP_009076.2| ENSPTRP00000018661 ENSPPYP00000011082 ENSGGOP00000000047 ENSGGOP00000022670 ENSP00000392095 ENSP00000400391 ENSGGOP00000000047 ENSGGOP00000022670 ENSNLEP00000022627 ENSPTRP00000018661 ENSP00000392095 ENSP00000400391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]