SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011083 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011083
Domain Number 1 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.92e-26
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 2 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-26
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 3 Region: 263-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.68e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 207-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.55e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 361-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.72e-18
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 174-221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000985
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011083   Gene: ENSPPYG00000009902   Transcript: ENSPPYT00000011516
Sequence length 418
Comment pep:known chromosome:PPYG2:19:37266243:37298812:-1 gene:ENSPPYG00000009902 transcript:ENSPPYT00000011516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQESVMFSDVSVDFSQEEWECLNDDQRDLYRDVMLENYSNLVSMGHSVSKPNVISYLEQ
GKEPWLVDRELTRGQWPVLESRCETKKLFLKKEIYEIESTQWEIMEKLTRHDFQCSSFRD
DWECNMQFKKQLGSQGGHFNQLVFTHEDLPTLSHHPSFTLQQIINSKKKFCASKEYRKTF
RHGSQFATHEIIHTIEKPYECKECGKSFRHPSRLAHHQKIHTGKKPFECKECGKTFICGS
DLTRHHRIHTGEKPYECKECGKAFSSGSNFTRHQRIHTGEKPYECKECGKAFSSGSNFTQ
HQRIHTGEKPYECKECGNAFSQSSQLIKHQRIHTGEKPYECKECEKAFRSGSDLTRHQRI
HTGEKPYECKICGKAYSQSSQLISHHRIHTSEKPYEYRECGKNFNYDPQLIQHQNLYW
Download sequence
Identical sequences H2NYK1
ENSPPYP00000011083 ENSPPYP00000011083 XP_009230771.1.23681 XP_009230772.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]