SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011087 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011087
Domain Number 1 Region: 344-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.25e-26
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.1e-24
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 3 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.8e-24
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 484-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.24e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 530-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-19
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 7 Region: 250-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-16
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 8 Region: 447-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000632
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000011087
Domain Number - Region: 189-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0011
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011087   Gene: ENSPPYG00000009905   Transcript: ENSPPYT00000011520
Sequence length 590
Comment pep:known_by_projection chromosome:PPYG2:19:37538268:37547456:1 gene:ENSPPYG00000009905 transcript:ENSPPYT00000011520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQGSVSFNDVTVDFTQEEWQHLDHAQKTLYMDVMLENYCHLISVGCHMTKPDVILKLERG
EEPWTSFAGHICLEENWKAEDFLVKFKEHQEKYSRSVVSINHKKLVKEKSKIYEKTFTLG
KNPVNSKNLPPEYDTHGRILKNVSELIISNLNPARKRLSEYNGYGKSFLSTKQETTHPEV
KSHNQSGRAFSHNEVLMQYQKTETPAQSFGYNDCEKSFLKRGGLITDSRPYRGENPSVYN
KKRRATDIEKKHTCNECGKSFCRKSVLILHQGIHSEEKPYQCHQCGNAFRRKSYLIDHQR
THTGEKPFVCNECGKSFRLKTALTDHQRTHTGEKSYECLQCRNAFRLKSHLIRHQRTHTG
EKPYECNDCGKSFRQKTTLSLHQRIHTGEKPYICKECGKSFHQKANLTVHQRTHTGEKPY
ICNECGKSFSQKTTLALHEKTHNEEKPYICSECGKSFRQKTTLVAHQRTHTGEKSYECPH
CGKAFRMKSYLIDHHRTHTGEKPYECNECGEAFSEKTNHNLHQRIHTGEKPYICNECGKS
FRQKATLTVHQKIHTGQKSYECPQCGKAFSRKSYLIHHQRTHKGENIEMQ
Download sequence
Identical sequences H2NYK5
ENSPPYP00000011087 ENSPPYP00000011087 9600.ENSPPYP00000011087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]