SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011094 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011094
Domain Number 1 Region: 502-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.91e-26
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 558-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 670-727
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.91e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 614-671
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.15e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 22-80
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.29e-24
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 6 Region: 447-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 7 Region: 390-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.31e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 8 Region: 166-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 278-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.24e-22
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 10 Region: 334-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-20
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 11 Region: 712-764
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.65e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 12 Region: 223-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.3e-20
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 13 Region: 128-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000448
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011094   Gene: ENSPPYG00000009909   Transcript: ENSPPYT00000011527
Sequence length 769
Comment pep:known chromosome:PPYG2:19:37960868:38001754:-1 gene:ENSPPYG00000009909 transcript:ENSPPYT00000011527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPANWTSPQKSSALAPEDHGSSYEGSVSFRDVAIDFSREEWRHLDPSQRNLYRDVMLETY
SHLLSVGYQVPKPEVVMLEQGKEPWALQGERPRHSCPGEKLWDHNQHRKIIGYKPASSQD
QKIYSGEKSYECAEFGKSFTWKSQFKVHLKVPTGEKLYVCIECGRAFVQKPEFITHQKTH
MREKPYKCNECGKSFFQVSSLFRHQRIHTGEKLYQCSECGKGFPYNSDLSIHEKIHTGER
HHECTDCGKAFTQKSTLKMHQKIHTGERSYICIECGQAFIQKTQLIAHRRIHSGEKPYEC
NNCGKSFISKSQLEVHQRIHTRLKPYICTEYGKVFSNNSNLITHEKVQSREKSSICTECG
KAFTYRSELIIHQRIHTGEKPYACSDCGKAFTQKSTLTVHQRIHTGEKSYVCMKCGLAFI
RKAHLVTHQIIHTGEKPYKCGHCGKLFTSKSQLHVHKRIHTGEKPYVCNKCGKAFTNRSN
LITHQKTHTGEKSYICSKCGKAFTQRSDLITHQRIHTGEKPYECNTCGKAFTQKSNLNIH
QKIHTGERQYECHECGKAFNQKSILIVHQKIHTGEKPYVCTECGRAFIRKSNFITHQRIH
TGEKPYECSDCGKSFTSKSQLLVHQPLHTGEKPYVCAECGKAFSGRSNLSKHQKTHTGEK
PYICSECGKTFRQKSELITHHRIHTGEKPYECSDCGKSFTKKSQLQVHQRIHTGEKPYVC
AECGKAFTDRSNLNKHQTTHTGDKPYKCGICGKGFVQKSVFSVHQSNHA
Download sequence
Identical sequences H2NYL2
ENSPPYP00000011094 ENSPPYP00000011094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]