SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011095 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011095
Domain Number 1 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7e-26
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-25
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 4 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 207-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 6 Region: 416-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-21
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 150-207
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.9e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011095   Gene: ENSPPYG00000009910   Transcript: ENSPPYT00000011528
Sequence length 475
Comment pep:known_by_projection chromosome:PPYG2:19:38058369:38071208:1 gene:ENSPPYG00000009910 transcript:ENSPPYT00000011528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGSVMFSDVSIDFSQEEWDCLDPVQRDLYRDVMLENYSNLVSMGLYTPKPQVISLLEQ
GKEPWMVGRELTRGLCSDLESMCETKLLSLKKEVYEIELCQREIMGLTKHGLEYSSFGDV
LEYRSHLAKQLGYPNGHFSQDIFTPEYMPTFIQQTFLTLHQIINNEDRPYECKKCGKAFS
QNSQFIQHQRIHIGEKSYECKECGKFFSCGSHVTRHLKIHTGEKPFECKECGKAFSCSSY
LSQHQRIHTGKKPYECKECGKAFSYCSNLIDHQRIHTGEKPYECKVCGKAFTKSSQLFQH
ARIHTGEKPYECKECGKAFTQSSKLVQHQRIHTGEKPYECKECGKAFSSGSALTNHQRIH
TGEKPYDCKECGKAFTQSSQLRQHQRIHAGEKPFECLECGKAFTQNSQLFQHQRIHTDEK
PYECNECGKAFNKCSNLTRHLRIHTGEKPYNCKECGKAFSSGSDLIRHQGIHTNE
Download sequence
Identical sequences H2NYL3
XP_002829180.1.23681 XP_009230802.1.23681 ENSPPYP00000011095 ENSPPYP00000011095 9600.ENSPPYP00000011095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]