SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011108 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011108
Domain Number 1 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.41e-23
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 260-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.4e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 485-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 204-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 4-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-21
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 6 Region: 596-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.96e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 7 Region: 540-597
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 8 Region: 149-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 362-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 10 Region: 643-694
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.8e-17
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 11 Region: 94-150
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.1e-17
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 12 Region: 302-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000158
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 13 Region: 447-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000344
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011108   Gene: ENSPPYG00000009921   Transcript: ENSPPYT00000011543
Sequence length 695
Comment pep:known_by_projection chromosome:PPYG2:19:38525321:38551184:-1 gene:ENSPPYG00000009921 transcript:ENSPPYT00000011543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACGSITFRDVAIDFSHQEWEYLNLVQKTLYQEVMMENYDNLVLLGHSKSKPDLITLLEQ
GKEPWMIVREETRGECTDLDSRCEIISDGKMQLYRKHSSVTLHQRIHNGQKPYECKECQK
SFSHLTELMVHQTIHTSEEPDQCEEFGKAFSHLTDLRKHQKIHAREKPYECEECGKVFSY
PANLAQHGKVHVEKPYECKECGEAFRTSRQLTVHHRFHYGEKPYECKECGKAFSVYGRLS
RHQSIHTGEKPFECNKCGKSFRLKAGLKVHQSIHTGEKPHECKECGKAFRQFAHLVGHKR
IHTGEKPYECKECGKGFTCRYQLTMHQRIYSGEKPYECKENGEAFSSGHQLTAPHTFESV
EKPYKCEECGKAFSVHGRLTRHQGIHSGKKPYECNKCGKSFRLNSSLKIHQNIHTGEKPY
KCKECGKAFSQRAHLAHHNRIHTGYKPFECKECGKSFRCASYLVIHERIHTGEKPYVCQE
CGKGFSYRHKLTIHRRVHTGEKPYECKECGKAFSVSAQLTQHLSIHSGKKPFECNQCGKS
FKFISVLKAHQNIHSAEKPYECKECGKAFRHATSLIYHDRTHAGEKSYECKECGETFSHA
SHLIIHERIHTGDKPYECKRCGKAFHCASYLVRHESVHADRNPYMCEECGKAFNSSHELS
IHHRVHTGEKPFKCNKCRRSFRLRSILEVHQRIHV
Download sequence
Identical sequences H2NYM6
XP_009230823.1.23681 ENSPPYP00000011108 ENSPPYP00000011108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]