SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011209 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPPYP00000011209
Domain Number - Region: 15-116
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0687
Family Synaptotagmin-like (S variant) 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011209   Gene: ENSPPYG00000010014   Transcript: ENSPPYT00000011647
Sequence length 175
Comment pep:known_by_projection chromosome:PPYG2:19:42483333:42494081:-1 gene:ENSPPYG00000010014 transcript:ENSPPYT00000011647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEVHVIGQIMGASGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHP
IDLHFATKGLQGWPRLHFQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTWRPLGSWR
EQLARAFVGGGPQLLHGDTIYSGADRYRLHTAAGGTVHLEISLLLRNFDRYGVEC
Download sequence
Identical sequences A0A0A0MVF1 A0A2K5H9K3 A0A2K5NMC5 A0A2K5XCX8 A0A2K6DTG2 F7HCV2 H2NYX6
ENSMMUP00000031223 NP_001248004.1.72884 XP_002829307.1.23681 XP_011762972.1.29376 XP_011762973.1.29376 XP_011789118.1.43180 XP_011791915.1.43180 XP_011838750.1.47321 XP_011942241.1.92194 XP_011942242.1.92194 XP_014979509.1.72884 XP_014979510.1.72884 ENSPPYP00000011209 ENSMMUP00000031223 ENSPANP00000006202 9544.ENSMMUP00000031223 9600.ENSPPYP00000011209 ENSPPYP00000011209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]