SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011276 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011276
Domain Number 1 Region: 481-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 312-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.46e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 425-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 369-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.96e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 565-621
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 610-662
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.95e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 2-54
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-19
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 8 Region: 260-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-18
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 9 Region: 145-201
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000109
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 10 Region: 200-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000226
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 11 Region: 527-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000175
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011276   Gene: ENSPPYG00000010079   Transcript: ENSPPYT00000011716
Sequence length 681
Comment pep:known_by_projection chromosome:PPYG2:19:45155262:45179034:-1 gene:ENSPPYG00000010079 transcript:ENSPPYT00000011716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKSKEAVTFKDVAVVFSEEELQLLDLAQRKLYRDVMLENFRNVVSVGHQSTPDGLPQLE
REEKLWMMKMATQRDNSSGSKNLKEMETLQEVGLRYLPHEELFCSQIWQQITRELIKYQD
SVVNIQRTGCQLEKRDDLHYKDEGFSNQSSHLQVHRVHTGEKPYRGEHCVKSFSWSSHLQ
INQRAHAGEKPYKCEKCDNAFRRFSSLQAHQRVHSTAKSYTSDATYRSFSQRSHLHHHRR
VPTGENPYKYEECGRNVGKSSHCQAPLIVHMGEKPYKCEECGVGFSQRSYLQVHLKVHAG
KKPYKCEECGKSFSWRSRLQAHERIHTGEKPYKCNACGKSFSYSSHLNIHCRIHTGEKPY
KCEECGKGFSVGSHLQAHQISHTGEKPYKCEECGKGFCRASNLLDHQRGHTGEKPYQCDA
CGKGFSRSSDFNIHFRVHTGEKPYKCEECGKGFSQASNLLAHQRGHTGEKPYKCGTCGKG
FSRSSDLNVHCRIHTGEKPYKCEKCGKAFSQFSSLQVHQRVHTGEKPYQCAECGKGFSVG
SQLQAHQRCHTGEKPYQCEECGKGFCRASNFLAHRGVHTGEKPYRCDVCGKRFRQRSYLQ
AHQRVHTGERPYKCEECGKVFSWSSYLQAHQRVHTGEKPYKCEECGKGFSWSSSLIIHQR
VHADDEGDKDFPSSEDSHRKT
Download sequence
Identical sequences H2NZ42
ENSPPYP00000011276 XP_009230993.1.23681 ENSPPYP00000011276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]