SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011277 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011277
Domain Number 1 Region: 263-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.8e-23
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 206-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.67e-22
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 3 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 23-84
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 5 Region: 431-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.24e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 375-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.91e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 486-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.89e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 530-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.9e-17
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 9 Region: 168-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000691
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011277   Gene: ENSPPYG00000010080   Transcript: ENSPPYT00000011717
Sequence length 617
Comment pep:known_by_projection chromosome:PPYG2:19:45218160:45222817:1 gene:ENSPPYG00000010080 transcript:ENSPPYT00000011717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISPSLELLHSGLCKFPEVEGKMTTFKEAVTFKDVAVVFTEEELGLLDPAQRKLYRDVML
ENFRNLLSVGNQQFHQDTFHFLRKEKFWMMKTTSQREGNSEGKIQIEMETVPEAGPHEEW
SCQQIWEQIASDLTRSQNSIRNSSQFFKEGDVPCQIEAGLSISHVQQKPYWCNECKQSFS
DVSVFDLHQQSHSGEKSHTCGECGKSFCYISALHIHQRVHMGEKCYKCDVCGKEFNQSSH
LQTHQRVHTGEKPFKCGQCGKGFHSRSALNVHCKLHTGEKPYNCEECGKAFIHDSQLQEH
QRIHTGEKPFKCDICGKSFRVRSRLNRHSMVHTGEKPFRCDACGKNFRQRSALNSHSMVH
IGEKPYKCEQCGKGFICRRDFCKHRMVHTGEKPYNCKECGKTFRWSSCLLNHQRVHSGQK
PFKCEECGKGFYTNSQRSSHQRSHNGEKPYKCEECGKDYKRRLDLEFHQRVHTGERPYNC
KECGKSFGWASCLLKHQRLHSGEKPFKCEECGKRFTQSSQLHSHQTCHTGEKLYKCEQCE
KGYNSKFNLDMHQRVHRGERPYNCKECGKSFGWASCLLKHQRLHSGEKPLKSGVWEEICS
EFTASFTSVSLCGRKAI
Download sequence
Identical sequences H2NZ43
XP_002829387.1.23681 9600.ENSPPYP00000011277 ENSPPYP00000011277 ENSPPYP00000011277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]