SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011284 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011284
Domain Number 1 Region: 635-692
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.94e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 524-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.66e-25
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 3 Region: 580-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-24
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 412-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 468-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 355-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.77e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 7 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.09e-22
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 8 Region: 314-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-18
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 9 Region: 681-733
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.92e-17
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 10 Region: 252-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000393
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011284   Gene: ENSPPYG00000010086   Transcript: ENSPPYT00000011724
Sequence length 738
Comment pep:known chromosome:PPYG2:19:45510872:45530756:-1 gene:ENSPPYG00000010086 transcript:ENSPPYT00000011724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKFREAVTFKDVAVAFTEEELGLLDSAQKKLYRDVMLENFRNLVSVGHQSFKPDMISQL
EMEEKLWMKELQTQRGKDSGDRNQNEMATLHKAGLRCFSLGELSCWQIKRHIASKLARSQ
DSMINIEGKSSQFPKHHDSPCQVGAGESIQASVDDNCLVNHIGDYSSIIENQEFPTGKVL
NSWSKIYLNETQNYQRSCKQTQMKNKLCIFAPYVDIFSCISHHRDDNIVHKRDKVHSNSD
CGKDTLKVSPLTQRSIHTGQKTYQGNECEEAFNDSSSLELHKQVHLGRKSPACSTHEKDP
SYTSGIPVQQSVRTGKKRYWCHECGKGFSQSSNLQTHQRVHTGEKPYTCHECGKSFNQSS
HLYAHLPIHTGEKPYRCDSCGKGFSRSTDLNIHCRVHTGEKPYKCEVCGKGFTQRSHLQA
HERIHTGEKPYKCGDCGKRFSCSSNLHTHQRVHTEEKPYKCDECGKCFSLSFNLHSHQRV
HTGEKPYKCEECGKGFSSASSFQSHQRVHTGEKPFRCNVCGKGFSQSSYFQAHQRVHTGE
KPYKCEVCGKRFNWSLNLHNHQRVHTGEKPYKCEECGKGFSQASNLQAHQSVHTGEKPFK
CDACQKRFSQASHLQAHQRVHTGEKPYKCDTCGKAFSQRSNLQVHQIIHTGEKPFKCEEC
GKEFSWSAGLSAHQRVHTGEKPYTCQQCGKGFSQASHFHTHQRVHTGERPYICDVCCKGF
SQRSHLVYHQRVHTGGNL
Download sequence
Identical sequences H2NZ50
XP_009230979.1.23681 ENSPPYP00000011284 9600.ENSPPYP00000011284 ENSPPYP00000011284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]