SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011287 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011287
Domain Number 1 Region: 409-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 353-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 465-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.15e-22
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 510-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.09e-20
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 298-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-18
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 2-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-16
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 7 Region: 230-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000299
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 8 Region: 206-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000976
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000011287
Domain Number - Region: 120-185
Classification Level Classification E-value
Superfamily Profilin (actin-binding protein) 0.0971
Family Profilin (actin-binding protein) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011287   Gene: ENSPPYG00000010088   Transcript: ENSPPYT00000011727
Sequence length 590
Comment pep:known_by_projection chromosome:PPYG2:19:45612980:45626371:-1 gene:ENSPPYG00000010088 transcript:ENSPPYT00000011727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKFQERVTFKDVAVVFTNEELALLDKAQINLYQDVMLENFRNLISVKDGIKNNILNLQA
KGLSYLSQELLHCWQIWKQRIQDLTVSQDYIMNLQERCSPHLEDVSLSEEWAGMSLQISE
NENYVVNAIIKNQDTTAWQSLTQVLTPELWRKANIMTEPQNSQGRYKGIYMEEKLYRPAR
HDDSLNWTSCDHHVSQECKGEDPGRHPNCGKNLGMKSTVEQHNVAHVLPQPFTCNNCGMA
FADDTDPHFHHSTHLGEKSYKCDQYGKNFSQSQDLIVHCKTHAGETPYEFHEWPTGCKQS
SDLPRYQKVPSGDKPYKCKECGKGFRRNSSLHNHHRVHTGAMPYKCNICGKGFGFRSLLC
IHQGVHTGKKPYKCEECGKGFDQSSNLLVHQRVHTGEKPYKCSECGKCFSSSSVLQVHWR
FHTGEKPYRCGECGKGFSQSTHLHIHQRVHTGEKPYKCNVCGKDFAYSSVLHTHQRVHTG
EKPYKCEVCGKCFSYSSYFHLHQRDHTREKPYKCDECGKGFSRNSDLHVHLRVHTGERPY
KCKACGKGFSRNSYLLAHQRVHIDETQYTHCERGKDLLTHQRLHEQRETL
Download sequence
Identical sequences H2NZ53
ENSPPYP00000011287 ENSPPYP00000011287 XP_009231021.1.23681 9600.ENSPPYP00000011287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]