SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011288 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011288
Domain Number 1 Region: 385-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 609-665
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.13e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 3 Region: 552-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 721-777
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 665-721
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.74e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 442-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.75e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 766-818
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-19
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 348-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-19
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 9 Region: 498-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-18
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 10 Region: 28-79
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.89e-18
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 11 Region: 274-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000287
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000011288
Domain Number - Region: 208-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0702
Family Classic zinc finger, C2H2 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011288   Gene: ENSPPYG00000010089   Transcript: ENSPPYT00000011728
Sequence length 825
Comment pep:novel chromosome:PPYG2:19:45644500:45665950:-1 gene:ENSPPYG00000010089 transcript:ENSPPYT00000011728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLTSRHEKRALHSQASAVSQDREDKIMSQEPLSFKDVAVVFTEEELELLDSTQRQLYQ
DVMQENFRNLLSVGERNPLGDKNGKDMEYIQDEELRFFSHKELSSWKIWEEVAGELPGSQ
DCRVNLQGKDFQLSEDAAPHQGWEGASTPFFPIENFLDSLQGDGLISLENQQFPAWRAIR
PIPIQGSWAKAFVNQSGDVQERCKNLDTEDTVYKCNWDDYSFCWISCHVDHRVPEIDKPC
GCNKCRKDCIKNSVLHHISPGENGLKSNEYGNGFRDDSDRPPHPRVPLKEKPYQYHEFSK
GLRHSARLNRHQRIPTGEKSVKSLERGRGVRQNTHIHNHPRAPVGDMPYRCDVCGKGFRY
KSVLLIHQGVHTGRRPYKCEECGKAFGRSSNLLVHQRVHTGEKPYKCNECGKGFSYSSVL
QVHQRLHTGEKPYTCSECGKGFCAKSALHKHQHIHPGEKSYSCGECGKGFSCSSHLSSHQ
KTHTGERPYQCDKCGKGFSHNSYLQAHQRVHMGQHLYKCNVCGKSFSYSSGLLMHQRLHT
GEKPYKCKCGKSFGRSSDLHIHQRVHTGEKPYKCSECGKGFRRNSDLHSHQRVHTGERPY
VCDVCGKGFIYSSDLLIHQRVHTGEKPYKCAECGKGFSYSSGLLIHQRVHTGEKPYRCQE
CGKGFRCTSSLHKHQRVHTGKKPYTCDQCGKGFSYGSNLRSHQRLHTGEKPYTCYECGKG
FRYGSGLLSHKRVHTGEKPYRCHVCGKGYSQSSHLQGHQRVHTGEKPYKCEECGKGFGRS
SCLHVHQRVHTGEKPYTCDVCGKGFSYTSGLRNHQRVHLGENPYK
Download sequence
Identical sequences H2NZ54
ENSPPYP00000011288 ENSPPYP00000011288 XP_002829407.1.23681 9600.ENSPPYP00000011288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]