SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011331 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011331
Domain Number 1 Region: 49-377
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.55e-79
Family Protein kinases, catalytic subunit 0.00000216
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000011331
Domain Number - Region: 463-525
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0392
Family Myosin rod fragments 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011331   Gene: ENSPPYG00000010132   Transcript: ENSPPYT00000011772
Sequence length 629
Comment pep:known_by_projection chromosome:PPYG2:19:47055320:47067876:-1 gene:ENSPPYG00000010132 transcript:ENSPPYT00000011772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEVRLRRLQQLMLDPGFLGLEPLLDLLLGVHQELGASELAQDKYVADFLQWAEPIVVR
LKEVRLQRDDFEILKVIGRGAFSEVAVVKMKQTGQVYAMKIMNKWDMLKRGEVSCFREER
DVLVNGDRRWITQLHFAFQDENYLYLVMEYYVGGDLLTLLSKFGERIPAEMARFYLAEIV
MAIDSVHRLGYVHRDIKPDNILLDRCGHIRLADFGSCLKLRADGTVRSLVAVGTPDYLSP
EILQAVGGGPGTGSYGPECDWWALGVFAYEMFYGQTPFYADSTAETYGKIVHYKEHLSLP
LADEGVPEEARDFIQRLLCPPETRLGRGGAGDFRTHPFFFGLDWDSLRDSVPPFTPDFEG
ATDTCNFDLVEDGLTAMVSGGGETLSDIQEGAPLGVHLPFVGYSYSCVALRDSEVPGPTP
MELEAEQLLEPHVQAPSLEPSVSPQDETAKVAVPAAIPAAEAEAEVTLRELQEALEEEVL
TRQSLSREMEAIRTDNQNFASQLREAEARNRDLEAHVRQLQERMELLQAEGATAVTGVPS
PRATDPPSHLDGPPAVALGQCPLVGPGPMHRRHLLLPARVPRPGLSEALSLLLFAVALSR
VAALGCIGLVAHAGQLTAVWRRPGAARAP
Download sequence
Identical sequences H2NZ96
ENSPPYP00000011331 XP_009231068.1.23681 ENSPPYP00000011331 9600.ENSPPYP00000011331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]