SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011369 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011369
Domain Number 1 Region: 305-391
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000982
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00094
Further Details:      
 
Domain Number 2 Region: 146-198
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000144
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.034
Further Details:      
 
Domain Number 3 Region: 45-97
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000641
Family HLH, helix-loop-helix DNA-binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011369   Gene: ENSPPYG00000010165   Transcript: ENSPPYT00000011811
Sequence length 590
Comment pep:known_by_projection chromosome:PPYG2:19:48422332:48448919:1 gene:ENSPPYG00000010165 transcript:ENSPPYT00000011811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPYPGSGGGSEVKCVGGRGASVPWDFLPGLMVKAPSGPCLQAQRKEKSRNAARSRRGK
ENLEFFELAKLLPLPGAISSQLDKASIVRLSVTYLRLRRFAALGAPPWGLRAAGPPAGLA
PGRRGPAALVSEVFEQHLGGHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQVEMTGS
SVFDYIHPGDHSEVLEQLGLRTPTPGPPTPPSVSSSSSSSSSLADTPEIEASLTKVPPSS
LVQERSFFVRMKSTLTKRGLHVKASGYKVIHVTGRLRAHALGLVALGHTLPPAPLAELPL
HGHMIVFRLSLGLTILACESRVSDHMDLGPSELVGRSCYQFVHGQDATRIRQSHVDLLDK
GQVMTGYYRWLRRAGGFVWLQSVATVAGSGKSPGEHHVLWVSHVLSQAEGGQTPLDAFQL
PASMACEEASSPGPEPTEPEPPTEGKQAAPAENEAPQTQGKRIKVEPGPRETKGSEDSGD
EDPSGHPATPRPEFTSVIRAGVLKQDPVRPWGLAPPGDPPPTLLHAGFLPPVVRGLCTPG
AIRYGPAELGLVYPHLQRLGPGPALPEAFYPPLGLPYPGPAGTRLPRKGD
Download sequence
Identical sequences H2NZD0
XP_003779257.1.23681 9600.ENSPPYP00000011369 ENSPPYP00000011369 ENSPPYP00000011369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]