SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011495 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011495
Domain Number 1 Region: 9-249,351-388
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.45e-34
Family FAD-linked reductases, N-terminal domain 0.0031
Further Details:      
 
Domain Number 2 Region: 230-336
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.03e-28
Family L-aminoacid/polyamine oxidase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011495   Gene: ENSPPYG00000010269   Transcript: ENSPPYT00000011938
Sequence length 449
Comment pep:known_by_projection chromosome:PPYG2:19:51439365:51445515:-1 gene:ENSPPYG00000010269 transcript:ENSPPYT00000011938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLILHKLCQGLGLNLTKFTQYDKNTWTEVHEVKLRNYVVEKMPEKLGYALRPQEKGHS
PEDIYQMALNQALKDLKALGCRKAMKKFERHTLLEYLLGEGNLSRPAVQLLGDVMSEDGF
FYLSFAEALRAHSCLSDRLQYSRIVGGWDLLPRALLSSLSGLVLLNAPVVAMTQGPHDVH
VQIETSPLERNLKVLKADVVLLTASGPAVKRITFSPPLPRHMQEALRRLHYVPATKVFLS
FRRPFWREEHIEGGHSNTDRPSRMIFYPPPREGALLLASYTWSDAAATFAGLSREEALRL
ALDDVAALHGPVVRQLWDGTGVVKRWAEDPHSQGGFVVQPPALWQTENDYWTVPYGRIYF
AGEHTAYPHGWVETAVKSALRAAIKINSRKGPASDTASPERHASDMEGQGHVHGVAGSPS
HDLAKEEGSHPPVQGQFSLQNTTHRRTSH
Download sequence
Identical sequences H2NZQ2
ENSPPYP00000011495 9600.ENSPPYP00000011495 ENSPPYP00000011495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]