SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011502 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011502
Domain Number 1 Region: 762-819
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 706-763
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 380-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.98e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 650-707
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 435-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 804-856
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-16
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 477-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000216
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 556-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000053
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 9 Region: 310-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000015
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 207-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000162
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 272-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000405
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 12 Region: 2-52
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000017
Family KRAB domain (Kruppel-associated box) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011502   Gene: ENSPPYG00000010275   Transcript: ENSPPYT00000011945
Sequence length 867
Comment pep:known_by_projection chromosome:PPYG2:19:51580998:51604147:1 gene:ENSPPYG00000010275 transcript:ENSPPYT00000011945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEFVTLKDVGMDFTLGDWEQLGLEQGDMFWDTALDSCQDLFLLNPPRPNLTSHPDGDE
DLEPLAGGSPEATGPDVTETKNSPLMEDFFEEGFSQEIREMLSKDGFWNSNFGEACIEDT
WLDSLLGDPESLLRSDIATNGESPTECKSHELKRGLSPVSTVSTGEDSMVHNVSEKTLTP
AESKEYRGEFGSYSDHSQQDSVQEGEKPYQWSECGKSFSGSYHLTQHWITHTREKPTVYQ
GCEQGFDQNASLSVYPKTHTGYKFYVCNDFSQSTYLWHQKTHTGEKPCKSQDSDHPPSHD
TQPGEHQKTHTDSKSYNCNECGKAFTRIFHLTRHQKTHTRKRYECSKCQATFNLRKHLIQ
HQKTHAAKTTSECQECGKIFRHSSLLIEHQALHAGEEPYKCNERGKSFRHNSTLKIHQRV
HSGEKPYKCSECGKAFCRHTHLNEHRRIHTGYRPHKCQECVRSFSRPSHLMRHQAIHTAE
KPYSCAECKETFSDNSHLVQHQKMHTVKTPYECQECGERFICGSTLKCHQSVHAREKQGC
VVSGKILDQNPEQKEKCFKCNKCEKTFSCSKYLTQHERIHTRGVKPFECDQCGKAFGQST
RLIHHQRIHSRVRLYKRGDQGKAISSASLIKFQSSHTKEYPFKCNECGKTFSHSACLSKH
QLIHAGENPFKCSKCDRVFTQRNYLVQHERTHARKKPLVCNECGKTFRQSSCLSKHQRIH
SGEKPYVCDYCGKAFGLNAELVRHQRIHTGEKPYVCQECGKAFTQSSCLSIHRRVHTGEK
PYRCGECGKAFAQKANLTQHQRIHTGEKPYSCNVCGKAFVLSAHLNQHLRVHTQETLYQC
QRCHKAFRCHSSLTRHQRVHNKQQYCL
Download sequence
Identical sequences H2NZQ9
ENSPPYP00000011502 XP_002829645.1.23681 XP_009231202.1.23681 ENSPPYP00000011502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]