SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011506 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011506
Domain Number 1 Region: 78-764
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.26e-227
Family Motor proteins 0.0000000000000467
Further Details:      
 
Domain Number 2 Region: 882-998
Classification Level Classification E-value
Superfamily Myosin rod fragments 2.54e-20
Family Myosin rod fragments 0.0017
Further Details:      
 
Domain Number 3 Region: 1163-1280
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.54e-17
Family Myosin rod fragments 0.0038
Further Details:      
 
Domain Number 4 Region: 765-890
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000000000392
Family Myosin rod fragments 0.00069
Further Details:      
 
Domain Number 5 Region: 1444-1556
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000863
Family Myosin rod fragments 0.0041
Further Details:      
 
Domain Number 6 Region: 1597-1713
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000955
Family Myosin rod fragments 0.0062
Further Details:      
 
Domain Number 7 Region: 1020-1123
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000959
Family Myosin rod fragments 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000011506
Domain Number - Region: 1283-1381
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00034
Family Myosin rod fragments 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011506   Gene: ENSPPYG00000010278   Transcript: ENSPPYT00000011949
Sequence length 1857
Comment pep:known_by_projection chromosome:PPYG2:19:51708084:51835038:1 gene:ENSPPYG00000010278 transcript:ENSPPYT00000011949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVTMSVPGRKAPPRPGPVPEAAQPFLFTPRGPSAGGGPGSGTSPQVEWTARRLVWVPS
ELHGFEAAALRDEGEEEAEVELAESGRRLRLPRDQIQRMNPPKFSKAEDMAELTCLNEAS
VLHNLRERYYSGLIYTYSGLFCVVINPYKQLPIYTEAIVEMYRGKKRHEVPPHVYAVTEG
AYRSMLQGWLLEKSRAIRQAKDECSFHIFYQLLGGAGEQLKADLLLEPCSHYRFLTNGPS
SSPGQERELFQETLESLRVLGFTHEEIISMLRMVSAVLQFGNIALKRERNTDQATMPDNT
AAQKLCRLLGLGVTDFSRALLTPRIKVGRDYVQKAQTKEQADFALEALAKATYERLFRWL
VLRLNRALDRSPRQGASFLGILDIAGFEIFQLNSFEQLCINYTNEKLQQLFNHTMFVLEQ
EEYQREGIPWTFLDFGLDLQPCIDLIERPANPPGLLALLDEECWFPKATDKSFVEKVAQE
QGSHPKFQRPRHLRDQADFSVLHYAGKVDYKANEWLMKNMDPLNDSVAALLHQSTDRLTA
EIWKDVEGIVGLEQVSSLGDGPPGGRPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRC
IVPNHEKRAGKLEPRLVLDQLRCNGVLEGIRICRQGFPNRILFQEFRQRYEILTPNAIPK
GFMDGKQACEKMIQALELDPNLYRVGQSKIFFRAGVLAQLEEERDLKVTDIIVSFQAAAR
GYLARRAFQKRQQQQSALRVMQRNCAAYLKLRHWQWWRLFTKVKPLLQVTRQDEVLQARA
QELQKVQELQQQSAREVGELQGRVAQLEEERARLAEQLRAEAELCAEAEETRGRLAARKQ
ELELVVSELEARVGEEEECSRQMQTEKKRLQQHIQELEAHLEAEEGARQKLQLEKVTTEA
KMKKFEEDLLLLEDQNSKLSKERKLLEDRLAEFSSQAAEEEEKVKSLNKLRLKYEATIAD
MEDRLRKEEKGRQELEKLKRRLDGESSELQEQMVEQQQRAEELRAQLGRKEEELQAALAR
AEDEGGARAQLLKSLREAQAALAEAQEDLESERLARTKAEKQRRDLGEELEALRGELEDT
LDSTNAQQELRSKREQEVTELKKTLEEETRIHEAAVQELRQRHGQALGELAEQLEQARRG
KGAWEKTRLALEAEVSELRAELSSLQTARQESEQRRRRLESQLQEVQGRAGDGERARAEA
AEKLQRAQAELDNVSGALNEAESKTIRLSKELSSIEAQLHDAQELLQEETRAKLALGSRV
RAMEAEAAGLREQLEEEAAARERAGRELQTAQAQLSEWRRRQEEEAGALEAGEEARRRAA
REAEALTQRLAEKTETVDRLERGRRRLQQELDDATMDLEQQRQLVSTLEKKQRKFDQLLA
EEKAAVLRAVEERERAEAEGREREARALSLTRALEEEQEAREELERQNRALRAELEALLS
SKDDVGKSVHELERACRVAEQAANDLRAQVTELEDELTAAEDAKLRLEVTVQALKTQHER
DLQGHDEAGEERRRQLAKQLRDAEVERDEERKQRTLAVAARKKLEGELEELKAQMASAGQ
GKEEAVKQLRKMQELAASDRARRQAQQDRDEMADEVANGNLSKAAILEEKRQLEGRLGQL
EEELEEEQSNSELLNDRYRKLLLQVESLTTELSAERSFSAKAESGRQQLERQIQELRGRL
GEEDAGARARHKMTIAALESKLAQAEEQLEQETRERILSGKLVRRAEKRLKEVVLQVEEE
RRVADQLRDQLEKGNLRVKQLKRQLEEAEEEASRAQAGRRRLQRELEDVTESAESMNREV
TTLRNRLRRGPLTFTTRTVRQVFRLEEGVASDEEAEEAQPGSGPSPEPEGSPPAHPQ
Download sequence
Identical sequences H2NZR3
ENSPPYP00000011506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]