SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011511 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011511
Domain Number 1 Region: 615-990
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 7.79e-115
Family DNA polymerase I 0.00001
Further Details:      
 
Domain Number 2 Region: 167-595
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.69e-102
Family DnaQ-like 3'-5' exonuclease 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011511   Gene: ENSPPYG00000010281   Transcript: ENSPPYT00000011954
Sequence length 1121
Comment pep:known_by_projection chromosome:PPYG2:19:51919219:51952254:1 gene:ENSPPYG00000010281 transcript:ENSPPYT00000011954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRSQRRVSPCSAIQRSLAGKGGRHTPRAVQRQRSQRPRGRTRPKACRMDGKRRPGPGPG
VPPKRARGGLWDDDDAPRPSQFEEDLALMEEMEAERRLQEQEEEELQSVLEGVVDGQVLP
SAIDPRWLRPTPPALDPQTEPLIFQQLEIDHYVGPAQPVPGGPPPSHGSVPVLRAFGVTD
EGFSVCCHIHGFAPYFYTPAPPGFGPEHLGDLQRELNLAISRDNRGGKELTGPAVLAVEL
CSRESMFGYHGHGPSPFLRITLALPRLVAPARRLLEQGIRVAGLGTPSFAPYEANVDFEI
RFMVDTDIVGCNWLELPAGKYALRLKEKATQCQLEVDVLWSDVVSHPPEGPWQRIAPLRV
LSFDIECAGRKGIFPEPERDPVIQICSLGLRWGEPEPFLRLALTLRPCAPILGAKVQSYE
KEEDLLQAWSTFIRIMDPDVITGYNIQNFDLPYLISRAQTLKVQTFPFLGRVAGLRSNIR
DSSFQSKQTGRRDTKVVSMVGRVQMDMLQVLLREYKLRSYTLNAVSFHFLGEQKEDVQHS
IITDLQNGNDQTRRRLAVYCLKDAYLPLRLLERLMVLVNAVEMARVTGVPLSYLLSRGQQ
VKVVSQLLRQAMHEGLLMPVVKSEGGEDYTGATVIEPLKGYYDVPIATLDFSSLYPSIMM
AHNLCYTTLLKPGAVQKLGLTEDQFIRTPTGDEFVKTSVRKGLLPQILENLLSARKRAKA
ELAKETDPLRRQVLDGRQLALKVSANSVYGFTGAQVGKLPCLEISQSVTGFGRQMIEKTK
QLVESKYTVENGYSTSAKVVYGDTDSVMCRFGVSSVAEAMALGREAADWVSGHFPSPIRL
EFEKVYFPYLLITKKRYAGLLSPSRPDAHDPEGAVAHAQDVISDLLCNRVDISQLVITKE
LTRAASDYAGKQAHVELAERMRKRDPGSAPSLGDRVPYVIISAAKGVAAYMKSEDPLFVL
EHSLPIDTQYYLEQQLAKPLLRIFEPILGEGRAEAVLLRGDHTRCKTVLTGKVGGLLAFA
KRRNCCIGCRTVLSHQGAVCEFCQPRESELYQKEVSHLNALEERFSRLWTQCQRCQGSLH
EDVICTSRDCPIFYMRKKVRKDLEDQEQLLRRFGPPGPEAW
Download sequence
Identical sequences H2NZR8
ENSPPYP00000011511 ENSPPYP00000011511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]