SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011569 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011569
Domain Number 1 Region: 381-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.06e-26
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 2-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.62e-26
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-23
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 4 Region: 297-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 437-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.3e-21
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 6 Region: 478-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.09e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 202-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-18
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 343-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000069
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000011569
Domain Number - Region: 168-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000655
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011569   Gene: ENSPPYG00000010329   Transcript: ENSPPYT00000012012
Sequence length 617
Comment pep:known_by_projection chromosome:PPYG2:19:53391114:53416983:1 gene:ENSPPYG00000010329 transcript:ENSPPYT00000012012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKSQESLTLEDVAVEFTWEEWQLLGPAQKDLYRDVMLENYSNLVSVGYQASKPDALFKL
DQGEPWTVENEIHSQICPEIKKVDNHLQMHSQNQRCLKRVEQCHKHNAFGNIIHQRKSDF
PLRQNHGTFDLHGKILKSNLSLVNQNKRYEINNSVGVNGDGKSFLHAKHEQFHNEMNFPE
GGNSMNTNSQFIKHQRTQKIDKPHVCTECGKAFLKKSRLIYHQRVHTGEKPHGCSICGKA
FSRKSGLTEHQRNHTGEKPYECTECDKAFRWKSQLNAHQKIHTGEKSYICGDCGKGFIKK
SRLINHQRVHTGEKPHGCSLCGKAFSKKSRLTEHQRTHTGEKPYECTECDKAFRWKSQLN
AHQKAHTGEKSYICRDCGKGFIQKGNLIVHQRIHTGEKPYICNECGKGFIQKGNLLIHRR
THTGEKPYVCNECGKGFSQKTCLISHQRFHTGKTPFVCTECGKSCSHKSGLINHQRIHTG
EKPYTCSDCGKAFRDKSCLNRHRRTHTGERPYGCSDCGKAFSHLSCLVYHKGMLHAREKR
VGSVKLENPCSESHSLSHTRDLIQDKDSVNMVTLQMPSVAVQTSLTNSAFQAVSKVAIVS
QPVARSSVSADSRICTE
Download sequence
Identical sequences H2NZX5
XP_009231276.1.23681 XP_009231277.1.23681 9600.ENSPPYP00000011569 ENSPPYP00000011569 ENSPPYP00000011569

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]