SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011573 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011573
Domain Number 1 Region: 294-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.1e-24
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 3 Region: 406-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-24
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 4 Region: 350-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 461-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.25e-22
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 6 Region: 503-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.28e-21
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 7 Region: 260-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000416
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 187-230
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000316
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011573   Gene: ENSPPYG00000010332   Transcript: ENSPPYT00000012016
Sequence length 583
Comment pep:known chromosome:PPYG2:19:53492319:53506524:-1 gene:ENSPPYG00000010332 transcript:ENSPPYT00000012016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKTQESLTLEDVAVEFSWEEWQLLDTAQKNLYRDVMVENYNHLVSLGYQTSKPDVLSKL
AHGQEPWITDAKIQNKNCPGIRKVDSHLQEHSPNQRLLKSVQQCNGQNTLRNIVRLSKTH
FPIVQNHDTFDLYRNLKSSLSLHQKRRHGINNPVEFIGGEKTLLHGKHERTHTKTRYSEN
AKRIHTKFQAFKHQRTQKIEKPHACIECEQTFFRKSQLIYHENICIQENPGSGQCEKLSR
SVLFTKHLKTNTRDKICIPNEYRKGSTVKSSLITHQETHTEEKSYMCSECGKGFTMKRYL
IAHQRTHSGEKPYVCNECGKGFTVKSNLIVHQRTHTGEKPYICSECGKGFTMKRYLVVHQ
RTHTGEKPYMCSECGKGFTVKSNLIVHQRSHTGEKSYICSECGKGFTVKRTLIIHQRTHT
GEKSYICNECGKGFTTKRTLIIHQRTHTGEKPYECNECGKAFSQKICLIQHERCHTGKTP
FVCTECGKSYSHKYGLITHQRIHTGEKPYKCNECGKAFTTKSVLNVHQRTHTGERPYGCS
DCEKAFSHLSNLVKHKKMHTREMGRISQVENSCNGESQLLPYK
Download sequence
Identical sequences H2NZX8
9600.ENSPPYP00000011573 ENSPPYP00000011573 ENSPPYP00000011573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]