SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011580 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011580
Domain Number 1 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.95e-27
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 196-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 281-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.42e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 4 Region: 392-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.93e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 20-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.36e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 438-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.87e-20
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 141-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.88e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 243-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000434
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011580   Gene: ENSPPYG00000010338   Transcript: ENSPPYT00000012023
Sequence length 492
Comment pep:known_by_projection chromosome:PPYG2:19:53789712:53815786:1 gene:ENSPPYG00000010338 transcript:ENSPPYT00000012023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCDEKAQKRRKRKAKKSGMALPQGHLTFRDVAIEFSQAEWKCLDPSQRALYKDVMLENY
RNLVSLGSSYALGSNAEDKPIKKQLGVSFHLHLSELELFPDERVINGCNQVENVINHSSS
VSSLQEISSSVKTPIFNRNDFDDSSFLPQEQKVHIREKPYECNEHSKVFRVSSSLSKHQV
IHTVEKPYKCNECGKVFSRNSHLAEHWRIHTGEKPYKCNDCGKVFSYNSNFARHQRIHTR
EKPYECNECGKVFSNNSYLARHQRIHAEEKPYKCNECGKGFSHKSSLANHWRIYTGEKPY
KCDECGKAFYRIALLVRHQKIHTGEKPYKCNECGKVFIQNSHLAQHWRIHTGEKPYKCNE
CGKVFNQLSNLARHRRIHTGEKPYKCNECGKAFSEYSGLSAHLVIHTGEKPYKCNECGKA
FRHKLSLTNHQRIHTGERPYKCNECGKVFNRIAHLARHRKIHTGEKPYKCNECGKAFSRI
SYLAQHWTIHMG
Download sequence
Identical sequences H2NZY5
XP_009231295.1.23681 ENSPPYP00000011580 ENSPPYP00000011580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]