SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011582 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011582
Domain Number 1 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.97e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 241-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.64e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 130-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.54e-24
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 185-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.28e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 353-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-23
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 409-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.31e-22
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 7 Region: 464-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000127
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 8 Region: 92-143
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000355
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011582   Gene: ENSPPYG00000010340   Transcript: ENSPPYT00000012025
Sequence length 515
Comment pep:known_by_projection chromosome:PPYG2:19:54163186:54164898:-1 gene:ENSPPYG00000010340 transcript:ENSPPYT00000012025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGRKDDAQNKPIKNQLGLNLQSHLPELQLFQAEGKIYKYDHMEKSVNSSSLDSPPQRIS
STVKTHISHTYEYNFMDSLFTKKEKANIGTEHYKCNECGKAFHQGLHFTIHQIIRTKETQ
FTCDICGKIFNKKSNLASHRRIHTGEKPYKCHECGKVFNNISHLAQHRRIHTGEKPYKCN
ECGKVFHQISHLAQHRTIHTGEKPYECNKCGKVFSHNSYLAQHLIIHTGEKPYKCNVCGK
VFNHISHLAQHRRIHTGEKPYKCNVCGKVFNHISHLANHRRIHTGEKPYKCNVCGKVFNH
ISHLANHWRIHTGEKPYKCNECGKVFSHKSSLANHWKIHTGEKPYKCNECGKVFSCNSYL
GQHVIIHTGEKPCKCDECDKVFSQNSHLVQHRRVHTGEKPYKCNECGKVFSQNSYLAYHR
RIHTGEPYKCNECGKVFSLNSSLAHHRKIHTGEKPYKCNECGKTFSMHSSLTNHHAIHTG
EKPFKCNERGKLFHDSSYLIHHQRIHAGEKSNKCN
Download sequence
Identical sequences H2NZY7
9600.ENSPPYP00000011582 ENSPPYP00000011582 ENSPPYP00000011582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]