SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011653 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011653
Domain Number 1 Region: 592-984
Classification Level Classification E-value
Superfamily RNI-like 5.1e-61
Family 28-residue LRR 0.00022
Further Details:      
 
Domain Number 2 Region: 27-115
Classification Level Classification E-value
Superfamily DEATH domain 4.24e-22
Family Pyrin domain, PYD 0.0048
Further Details:      
 
Domain Number 3 Region: 193-281,308-367
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000751
Family Nucleotide and nucleoside kinases 0.064
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000011653
Domain Number - Region: 540-599
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0824
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011653   Gene: ENSPPYG00000010394   Transcript: ENSPPYT00000012097
Sequence length 1002
Comment pep:known_by_projection chromosome:PPYG2:19:56754756:56779200:-1 gene:ENSPPYG00000010394 transcript:ENSPPYT00000012097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLEARPDLREFFSLNLRSHTWSTMTSPQLEWTLQTLLEQLNEDELKSFKSLLWALPLEDV
LQKTPWSEVEEADGKKLAEILVNTSSENWIRNATVNILEEMNLMELCKMAKAEMMEYGQV
QETDNPELEDAEEDSELAKPGVKEGRRNSMEKQSLVWKNTFWQGDIDSFHDDVTLRNLRF
IPFLNPITPRKLTPYTVVLHGPAGVGKTTLAKKCMLDWTDCNLSPTVRYAFYLSCKELSH
MGPCSFAELISKDWPELQDDIPSILAQAQRILFVVDGLEELKVPPGALIQDICGDWEKKK
PVPVLLGSLLNRYMLPKAALLVTTRPRALRDLQLLAQQPIYIRVEGFLEEDRRAYFLRHF
GDEDQAMRAFELMRSNAALFQLGSAPAVCWIVCTTLKLQMEKGEDPVPTCLTRTGLFLRF
LCSRFPQGAQLQGALRTLSFLAAQGLWAQMSVFHQEDLERLGVQESDLRLFLDGDILRQD
RVSKGCYSFIHLSVQQFFAGLFYALEKEEEDRDGHAWDIGDIQKLLSGEERVRNPDLIQV
GHFLFGLANEKRANELEAAFGCRISPDIKQELLRCKAHLHANKPLSMTDLKEVLVCLYES
QEEELAKVVVAPFKEISIHLTNTSEVMHCSFSLKHCQDLQKLSLQVAKGVFLENYMDSEL
DIEFERCTYLTIPNWARQDLRSLCLWTDFCSLFSSNSNLKFLEVKQSFLSDSSVRILCDH
ITRSTCHLQKVVIKNVTPDTAYRDFCLAFIGKKTLTHLTLEGHIEWERTMMLMLCDLLRN
HKCNLQYLRLGGHCATPEQWAEFFYVLKANQSLKHLHISANVLLDEGAKLLYKTMTHPEH
FLQMLSLENCRLTEASCKDLAAVLVVSKKLTHLCLAKNLIGDTGVKFLCEGLSYPECKLQ
TLVLQQCSITKLGCRYISEALQEACSLTNLDLSLNQIARGLWILCQALENPNCNLKHLRL
KSYGTSLEIKKLLEEVKEKNPKLTIDCNASGAMAPRCCDFFC
Download sequence
Identical sequences H2P056
ENSPPYP00000011653 ENSPPYP00000011653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]