SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011660 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011660
Domain Number 1 Region: 128-207
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0000000000876
Family Troponin T 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011660   Gene: ENSPPYG00000010401   Transcript: ENSPPYT00000012104
Sequence length 212
Comment pep:known_by_projection chromosome:PPYG2:19:57000002:57017887:-1 gene:ENSPPYG00000010401 transcript:ENSPPYT00000012104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQPEEEAAEEEEEAPEEPEPVAEPRPVVPPLIPPKIPEGERVDFDDIHRKRMEKDLLELQ
TLIDVHFEQRKKEEEELVALKERIERRRSERAEQQRFRTEKERERQAKLAEEKMRKEEEE
AKKRAEDDAKKKKVLSNMGAHFGGYLVKAEQKRGKRQTGREMKVRILSERKKPLDIDYMG
EEQLINVLYNRISPAQKFRKGAGKGRVGGRWK
Download sequence
Identical sequences H2P063
ENSPPYP00000011660 ENSPPYP00000011660 9600.ENSPPYP00000011660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]