SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011681 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011681
Domain Number 1 Region: 369-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 60-116
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 201-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-17
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 4 Region: 257-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000336
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 22-73
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000112
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 411-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000281
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 298-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000331
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 8 Region: 143-201
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000045
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 9 Region: 454-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000606
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000011681
Domain Number - Region: 106-138
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0111
Family Classic zinc finger, C2H2 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011681   Gene: ENSPPYG00000010423   Transcript: ENSPPYT00000012126
Sequence length 498
Comment pep:known_by_projection chromosome:PPYG2:19:57384137:57407462:-1 gene:ENSPPYG00000010423 transcript:ENSPPYT00000012126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDVPAPTSAPAPPAAAAPRVPFHCSECGKSFRYRSDLRRHFARHTALKPHACPRCGKGF
KHSFNLANHLRSHTGERPYRCSACPKGFRDSTGLLHHQVVHTGEKPYCCLVCELRFSSRS
SLGRHLKRQHQDTLYQCDCGTFFASAAALASHLEAHSGPATYGCGHCGALYAALAALEEH
RRVSHGRGKKIFGCSECEKLFRSPRDLERHVLVHTGEKPFPCLECGKFFRHECYLKRHRL
LHGTERPFPCHICGKGFITLSNLSRHLKLHRGMAPLPCPTCGRLFRFPYYLSRHRLSHSG
LRPHACPLCPKAFRRPAHLSRHLRGHGPQPPLRCAACPRTFPEPAQLRRHLAQEHAGAKR
HQCSICLKAFARPWSLSRHRLVHSTDRPFVCPDCGLAFRLASYLRQHRRVHAGEPRFWCP
ECGKGFRRRAHLRQHGVTHSGARPFQCVRCQREFKRLADLARHAQVHAGGPAPHPCPRCP
RRFSRAYSLLRHQRCHRA
Download sequence
Identical sequences H2P084
ENSPPYP00000011681 ENSPPYP00000011681 9600.ENSPPYP00000011681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]