SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011683 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011683
Domain Number 1 Region: 348-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-16
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 2 Region: 884-940
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-16
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 220-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.63e-16
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 4 Region: 929-981
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000209
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 575-627
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000459
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 6 Region: 828-884
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000741
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 664-714
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000451
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 546-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000455
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 9 Region: 407-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000614
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 989-1038
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000127
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 11 Region: 787-837
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000877
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011683   Gene: ENSPPYG00000010425   Transcript: ENSPPYT00000012128
Sequence length 1058
Comment pep:known_by_projection chromosome:PPYG2:19:57421781:57424957:1 gene:ENSPPYG00000010425 transcript:ENSPPYT00000012128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEANPAGSGAGGGGSSGIGGEDGVHFQSYPFDFLEFLNHQRFEPMELYGEHAKAVAALPC
APGPPPQPPPQPPPPQYDYPPQSTFKPKAEVPSSSSSSSSSSSSSSSSSSSSSSSSQAKK
PDPPLPPAFGAPPPPLFDAAFPTPQWGIVDLSGHQHLFGNLKRGGPASGPGVTPGLGAPA
GAPGPLPAPSQTPPGPPAAAACDPTKDDKGYFRRLKYLMERRFPCGVCQKSFKQSSHLVQ
HMLVHSGERPYECGVCGRTYNHVSSLIRHRRCHKDVPPAAGGPPQPGPPLPPLGLPAPAA
SAATAAAPSTVSSGPPATPAAPTPSADGSAAPAGVGVPPPATGGGDGPFACPLCWKVFKK
PSHLHQHQIIHTGEKPFSCSVCSKSFNRRESLKRHVKTHSADLLRLPCGICGKAFRDASY
LLKHQAAHAGAGAGGPRPVYPCDLCGKSYSAPQSLLRHKAAHAPPAAAAEAPKDGAASAP
QPPPTFPPGPYLLPPDPPTTDSEKAAAAAAAVVYGAVPVPLLGAHPLLLGGAGTSGAGGS
GASVPGKTFCCGICGRGFGRRETLKRHERIHTGEKPHQCPVCGKRFRESFHLSKHHVVHT
RERPYKCELCGKVFGYPQSLTRHRQVHRLQLPCALAGAAGLPSTQGAPGACGPGASGTSA
GPTDGLSYACSDCGEHFPDLFHVMSHKEVHMAEKPYGCDACGKTFGFIENLMWHKLVHQA
APERLLPPTPGGPQPPDGSSGTDAASVLDNGLAGEVGAAVAALAGVSGGEDAGGAAVAGV
GGGASSGPERFSCATCGQSFKHFLGLVTHKYVHLVRRTLGCGLCGQSFAGAYDLLLHRRS
HRQKRGFRCPVCGKRFWEAALLMRHQRCHTEQRPYRCGVCGRGFLRSWYLRQHRVVHTGE
RAFKCGVCAKRFAQSSSLAEHRRLHAVARPQRCSACGKTFRYRSNLLEHQRLHLGERAYR
CEHCGKGFFYLSSVLRHQRAHEPPRPELRCPACLKAFKDPGYFRKHLAAHQGGRPFRCSS
CGEGFANTYGLKKHRLAHKAENLGGPGAGAGTLAGKDA
Download sequence
Identical sequences H2P086
9600.ENSPPYP00000011683 ENSPPYP00000011683 XP_003779313.1.23681 XP_009231423.1.23681 ENSPPYP00000011683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]