SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011707 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011707
Domain Number 1 Region: 523-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-27
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 270-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-25
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 8-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-25
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 440-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 383-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.27e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 186-243
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 326-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-19
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 8 Region: 567-626
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.23e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 9 Region: 486-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000185
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 10 Region: 233-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000827
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011707   Gene: ENSPPYG00000010450   Transcript: ENSPPYT00000012153
Sequence length 626
Comment pep:known_by_projection chromosome:PPYG2:19:58518674:58533722:1 gene:ENSPPYG00000010450 transcript:ENSPPYT00000012153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVEVVKVMPQDLVTFKDVAIDFSQEEWQWMNPAQKCLYRSMMLENYQSLVSLGLCISKP
YVISLLEQGREPWEMTSEMTRSPFSDWESIYVTQELPLKQFMYDDACMEGITSYGLECST
FEENWKWEDLFEKQMGSHEMFSKKETITHKETITKETEFKYTKFGKCIHLENIEENIYNH
TSDKKSFSKNSMVIKHKKVYVGKKLFKCNECDKTFTHSSSLTVHFRIHTGEKPYACEECG
KAFKQRQHLAQHHRTHTGEKLFECKECRKAFKQSEHLIQHQRIHTGEKPYKCKECRKAFR
QPAHLAQHQRIHTGEKPYECKECGKAFSDGSSFARHQRCHTGKRPYECIECGKAFRYNTS
FIRHWRSYHTGEKPFNCIDCGKAFSVHIGLILHRRIHTGEKPYKCDVCGKTFSSGSSRTV
HQRIHTGEKPYECDICGKDFSHHASLTQHQRVHSGEKPYECKECGKAFRQNVHLVSHLRI
HTGEKPYECKECGKAFRISSQLATHQRIHTGEKPYECIECGNAFKQRSHLAQHQKTHTGE
KPYECNECGKAFSQTSNLTQHQRIHTGEKPYKCTECGKAFSDSSSCAQHQRLHTGQRPYQ
CFECGKAFRRKLSLICHQRSHTGEEP
Download sequence
Identical sequences H2P0B0
ENSPPYP00000011707 XP_009231458.1.23681 9600.ENSPPYP00000011707 ENSPPYP00000011707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]