SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011710 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011710
Domain Number 1 Region: 288-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.83e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.56e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 512-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.36e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 5 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.94e-23
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 6 Region: 73-117
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.2e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 7 Region: 557-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.61e-21
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 8 Region: 249-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.27e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011710   Gene: ENSPPYG00000010453   Transcript: ENSPPYT00000012156
Sequence length 610
Comment pep:known_by_projection chromosome:PPYG2:19:58604805:58635352:1 gene:ENSPPYG00000010453 transcript:ENSPPYT00000012156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIVLAERRAGECGCGVPPTPLPVPGAGPWPRGGRGLGERACRPSTVGHPRPVFLFTVGSR
GMAAQLLTDEALESVTFRDVTVDFTQEEWQQLEPAQKDLYRDVMLENYRNLVSLDWETRP
EMKELDPKNDISEDKPSVVGVATGGPARNGARGPGSEGVWEPGSWPERLWGDAGAEWEPL
GIPQGNKLLGGSVPGCHELKAFANQSCVLVPPRLDDPTEKGACPPIRRGKNFSSTSDLSK
PPMPCEEKKTYDCSECGKAFSRSSSLIKHQRIHTGEKPFECDTCGKHFIERSSLTIHQRV
HTGEKPYACGDCGKAFSQRMNLTVHQRTHTGEKPYVCDVCGKAFRKTSSLTQHERIHTGE
KPYACGDCGKAFSQNMHLIVHQRTHTGEKPYVCPECGRAFSQNMHLTEHQRTHTGEKPYA
CKECGKAFNKSSSLTLHQRNHTGEKPYVCGECGKAFSQSSYLIQHQRFHIGVKPFECSEC
GKAFSKNSSLTQHQRIHTGEKPYECYICKKHFTGRSSLIVHQIVHTGEKPYVCGECGKAF
SQSAYLIEHQRIHTGEKPYRCGQCGKSFIKNSSLTVHQRIHTGEKPYRCGECGKTFSRNT
NLTRHLRIHT
Download sequence
Identical sequences H2P0B3
ENSPPYP00000011710 ENSPPYP00000011710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]