SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011718 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011718
Domain Number 1 Region: 464-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.18e-24
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.3e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-23
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 5 Region: 352-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.37e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 510-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.97e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 296-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.67e-20
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 8 Region: 200-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-16
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011718   Gene: ENSPPYG00000010459   Transcript: ENSPPYT00000012164
Sequence length 628
Comment pep:known_by_projection chromosome:PPYG2:19:59236059:59299859:1 gene:ENSPPYG00000010459 transcript:ENSPPYT00000012164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVLTDRAQVSVTFDDVAVTFTKEEWGQLDLAQRTLYQEVMLENCGLLVSLGCPVPRP
ELIYHLEHEQETWTRKEDLSQGTCPGDKGKPKSTERTTCELGLSEGISFWGQLTQGASGD
SQLGQPKDQDGFSEMKGERLRPGLDSQKEKLPGKMSPKHDGLGTTDSVCSRIIQDQVSLG
DDVHDCDSRGSGKNPIIQEEENIFKCNECEKVFNKKRLLARHERIHSGVKPYECTECGKT
FSKSTYLLQHHMVHTGEKPYKCMECGKAFNRKSHLTQHQRIHSGEKPYKCSECGKAFTHR
STFVLHNRSHTGEKPFVCKECGKAFRDRPGFIRHYIIHSGENPYECFECGKVFKHRSYLM
WHQQTHTGEKPYECSECGKAFCESAALIHHYVIHTGEKPFECLECGKAFNHRSYLKRHQR
IHTGEKPYVCSECGKAFTHCSTFILHKRAHTGEKPFECKECGKAFSNRADLIRHFSIHTG
EKPYECMECGKAFNRRSGLTRHQRIHSGEKPYECIECGKTFCWSTNLIRHSIIHTGEKPY
ECSECGKAFSRSSSLTQHQRMHTGRNPISVTDMGRPFTSGQTSVNIQELLLGKNFLNVTT
EENLLQKEASYMASDRTYQRETPQVSSL
Download sequence
Identical sequences H2P0C1
ENSPPYP00000011718 ENSPPYP00000011718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]