SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011721 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011721
Domain Number 1 Region: 235-292
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 403-460
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 4-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-23
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 4 Region: 459-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-23
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 5 Region: 347-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.22e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 291-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-21
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 7 Region: 505-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 8 Region: 195-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-16
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011721   Gene: ENSPPYG00000010461   Transcript: ENSPPYT00000012167
Sequence length 600
Comment pep:known_by_projection chromosome:PPYG2:19:59363041:59372945:1 gene:ENSPPYG00000010461 transcript:ENSPPYT00000012167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASAQVSVTFEDVAVTFTQEEWGQLDAAQRTLYQEVMLETCGLLVSLGCPLFKPELIYQ
LDHRQELWMVTKDLSQSSYPGDNTKPKTTEPTFSHLALPEEVLLQERLTQGASKDSQLGQ
SKDQDGPSEMQEVHLKIGIGPQRGKLLETVSSERDGLGSDDGICTRITQKQVSTEDDLYE
YDSHGPVTDSLIREEKNSYKCEECGKVFKKNSLLVQHERIHTQVKPYECTECGKTFSKST
HLLQHHIIHTGEKPYKCMECGKAFNRRSHLTRHQRIHTGEKPYKCSQCGKAFTHRSTFVL
HNRSHTGEKPFVCKECGKAFRDRPGFIRHYIIHTGEKPYECIECGKAFSRRSYLTWHQQI
HTGVKPFECSECGKAFCESADLIQHYIIHTGEKPYKCMECGKAFNRRSHLKQHQRIHTGE
KPYECSECEKAFTHYSTFVLHKRTHTGEKPYECKECGKAFSDRADLIRHFSIHTGEKPYE
CVECGRAFNRSSHLTRHQQIHTGEKPYECIQCGKAFCRSANLIRHSIIHTGEKPYECSEC
GKAFNRGSSLTHHQRIHTGRNPTIVTDVGRPFMTAQTSVNIHELLLGKEFLNITTEENLW
Download sequence
Identical sequences H2P0C4
ENSPPYP00000011721 ENSPPYP00000011721 9600.ENSPPYP00000011721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]