SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011726 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011726
Domain Number 1 Region: 293-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.64e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 349-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-23
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 3 Region: 404-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.85e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 7-66
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.26e-20
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 5 Region: 237-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.96e-20
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 446-498
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.8e-19
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 200-250
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000188
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011726   Gene: ENSPPYG00000010464   Transcript: ENSPPYT00000012172
Sequence length 536
Comment pep:novel chromosome:PPYG2:19:59435959:59449206:1 gene:ENSPPYG00000010464 transcript:ENSPPYT00000012172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEMDPTHARVVFEDVAIYFSQEEWGHLDEAQRLLYRDVMLENLALLSSLGSWHGAEDEE
APSQQGFSVGVSEVTTSRPCLSSQKVHPSETCGPPLKDILCLVEHNGIHPEQDIYICETE
LFQHPKQQIGENLSRGDDWIPSFGKNHRVHVAEEIFTCMEGWKDLPATSCLLQHQGPQSE
WKPYRDTEDREAFQTGQNDYKCSECGKTFTCSYSFVEHQKIHTGERSYECNKCGKFFKYS
ANFMKHQTVHTSERTYECRECGKSFMYNYRLMRHKRVHTGERPYECNTCGKFFRYSSTFV
RHQRVHTGERPYECRECGKFFMDSSTLIKHQRVHTGERPYKCNDCGKFFRYISTLIRHQR
IHTGERPYECSVCGELFRYNSSLVKHWRNHTGERPYKCSECGKSFRYHCRLIRHQRVHTG
ERPYECSECGKFFRYNSNLIKHWRNHTGERPYECRECGKAFSHKHILVEHQKIHSGERPY
ECSECQKAFIRKSHLVHHQKIHSEERFVCSMNVGNSLAKTPTSLNIRDFTMEKVYH
Download sequence
Identical sequences H2P0C8
ENSPPYP00000011726 ENSPPYP00000011726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]