SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011743 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011743
Domain Number 1 Region: 39-128
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.05e-25
Family SCAN domain 0.0016
Further Details:      
 
Domain Number 2 Region: 349-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.82e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 310-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000123
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000011743
Domain Number - Region: 395-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00453
Family Classic zinc finger, C2H2 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011743   Gene: ENSPPYG00000010476   Transcript: ENSPPYT00000012190
Sequence length 433
Comment pep:known_by_projection chromosome:PPYG2:19:59754374:59757166:1 gene:ENSPPYG00000010476 transcript:ENSPPYT00000012190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDLRTIFQCEPSENNLGSENSEFRQSQGPAVQREEGISEFSRMVLNSFQDSNNSYARQ
ELQRLYRIFHSWLQPEKHSKDEIISLLVLEQFMIGGHCNDKASVKEKWKSSGKNLERFME
DLTDDSINPPALVHVHMQGQEALFSEDMPLKDVIVHLTKQVSAQTPREANMGTPSQTSQD
TSLETGEGCEDEQDGCNSSLKTTQVNENITNQGNQIVSLIIIQEENGPRSEEGGVSSDNP
NNSKRAELVTARSQEGSINGITFQGVPMEMGAGCISQPEQSSPESALTHQSNEGNSTCEV
HQKGSHGVRKSYKCEECPKVFKYLCHLLAHQRRHRNERPFVCPECQKGFFQISDLRVHQI
IHTGKKPFTCSMCEKSFSHKTNLRSHERIHTGEKPYTCPFCKTSYRQSSTYHRHMRTHEK
ITPPSVPSTPEAS
Download sequence
Identical sequences A2T7G6 H2P0E3
XP_002829922.1.23681 9600.ENSPPYP00000011743 ENSPPYP00000011743 ENSPPYP00000011743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]