SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011749 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011749
Domain Number 1 Region: 378-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.14e-24
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 2 Region: 45-105
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.23e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 322-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 477-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.83e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 5 Region: 283-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-18
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 433-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-18
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 7 Region: 163-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000597
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000011749
Domain Number - Region: 232-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000191
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011749   Gene: ENSPPYG00000010482   Transcript: ENSPPYT00000012196
Sequence length 554
Comment pep:known_by_projection chromosome:PPYG2:19:59804330:59814534:-1 gene:ENSPPYG00000010482 transcript:ENSPPYT00000012196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILSPVPRDASYALRGRKCLRLRSRRLPLPAAVRAHGPMAELTDSARGCVVFEDVFVYFSQ
EEWELLDDAQRLLYHDVMLENFALLASLGIAFSRSRAVMQLERGEEPWVYDQVDMTSATE
REAQRGLRPGCWHGVEDEEVSSEQSIFVAGVSEVRTLVAELESHPCDICGPILKDTLHLA
KYRGGRSRQKPYLCGACGKQFWFNTDFDQHQNQPNGGKLFPRKEGRDSVKSCRVHMPEKT
LTCGKGRRDFSATSGLLQHQASHSRMKPHKSTKLVSGFLTGQRYHKCGECGKAFTRKDTL
ARHQRIHTGERPYECNECGKFFSQSYDLFKHQTVHTGERPYECSECGKFFRQISGLIEHR
RVHTGERLYQCGKCGKFFSSKSNLIRHQEVHTGARPYVCSECGKEFSRKHTLVLHQRTHT
GERPYECSECGKAFSQSSHLNVHWRIHSSDYECSRCGKAFSCISKLIQHQKVHSGEKPYE
CSKCGKAFTQRPNLIRHWKVHTGERPYVCSECGREFIRKQTLVLHQRVHAGEKKSVANVG
ESLRPMPPTYCMVG
Download sequence
Identical sequences H2P0E9
ENSPPYP00000011749 9600.ENSPPYP00000011749 ENSPPYP00000011749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]