SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011755 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011755
Domain Number 1 Region: 247-299
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000176
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 2 Region: 31-81
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.000000000000119
Family SCAN domain 0.00048
Further Details:      
 
Domain Number 3 Region: 333-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000392
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011755   Gene: ENSPPYG00000010489   Transcript: ENSPPYT00000012203
Sequence length 365
Comment pep:known_by_projection chromosome:PPYG2:19:60149565:60172021:1 gene:ENSPPYG00000010489 transcript:ENSPPYT00000012203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRPKAPASPRRPQTPTPFFQDADPGPASPRDTEAQRLRFRQFHYKVAGGPHLALGQLY
TLCRQWLRPEARSKEQMQQEVLVSLDSVEHQDWSFGEEEDGKSPRSQREPSQASELILDA
AAAAPALPEESEWLETTQLSQSLHTRAEAEAPRAPGLLGSRARLPLKPSIWDEPEDLLAG
PSSDLRAEGTVISGPKSPSAQRISPRRRNKNTEQSGRHQPSLKHTKGGTQEAVSGISAVP
RGPRGGRPFQCADCGMVFTWVTHFIEHQKTHREEGPFPCPECGKVFLHSSVLTEHGKIHL
LEPPRKKAPRSKGPRESVPPRDGAQGPVAPRSPKRPFQCSVCGKAFPWMVHLIDHQKLHT
AHGHM
Download sequence
Identical sequences H2P0F5
ENSPPYP00000011755 ENSPPYP00000011755 9600.ENSPPYP00000011755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]