SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011766 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011766
Domain Number 1 Region: 372-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.75e-23
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 469-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 4 Region: 269-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.5e-20
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000011766
Domain Number - Region: 222-255
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000863
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 195-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0724
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011766   Gene: ENSPPYG00000010499   Transcript: ENSPPYT00000012214
Sequence length 531
Comment pep:known_by_projection chromosome:PPYG2:19:60493262:60494857:-1 gene:ENSPPYG00000010499 transcript:ENSPPYT00000012214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPAQKAGQGGIPKADAQGASGAQEKRPEEPRPLEEDRAGSRPTQKGDLRGAAGGRTTP
PGGGSQGCSLGVSPGPGTRHSAGTRPLVREPCGPTSSQDPELVIPEGLQAQEGPCRSPAR
GGDCSRNSCLARHRGAPAGETPPVCDPCPERLRNRSWTQLCEVHTDCWPCQPGTGAPTCP
RTPKPTSRGRSPLVEQPRACACGEAFAWRAVRIPQERLPATEDPRPCAQCGKRFRPNQQQ
QTGKSPPVCPECGQTSRPRPIVPDPPAQRLYACDECGKAFTRTSSLLQHQRIHTGERPYE
CAECGKAFVRCSGLYRHQKTHSAERHRRGPVLARRAFWLGCPPCGDCSERSPRRGSGPGE
KPYECADCAKAFGLFSHLVEHRRVHTGEKPYACPECGKAFNQRSNLSRHQRTHSSAKPYA
CPLCEKAFKGRSGLVQHQRAHTGERPYGCPECGKTFRGCSELRQHERLHSGEKPYICRDC
GKAFVRNCSLVRHLRTHTGERPYACGECGRAFSQRSNLNEHQKRHAGRAAP
Download sequence
Identical sequences H2P0G6
XP_009231540.1.23681 XP_009231541.1.23681 ENSPPYP00000011766 9600.ENSPPYP00000011766 ENSPPYP00000011766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]