SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011799 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011799
Domain Number 1 Region: 129-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.14e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 353-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 3 Region: 185-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.35e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 242-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.61e-22
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 395-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-20
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 7 Region: 87-139
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-19
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011799   Gene: ENSPPYG00000010535   Transcript: ENSPPYT00000012253
Sequence length 454
Comment pep:known_by_projection chromosome:PPYG2:19_random:3290722:3292086:-1 gene:ENSPPYG00000010535 transcript:ENSPPYT00000012253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LESRYRTNTLSPEKDIYEIYSFQWDIMERIKSYSLQGSIFRNDWECKSKIEGEKEQQEGY
FGQVKITSEKMTTYKRHNFLTEYQIVHNGEKVYECKECRKTFIRRSTLSQHLRIHTGEKP
YKCKECGQAFRQRAHLIRHHKLHTGEKPYECKECGKAFTVLQELTQHQRLHTGEKPYECK
ECGKAFRVHQQLARHQRIHTGEKPYECKDCGKTFRQCTHLTRHQRLHTAEKLYECKECGK
AFVCGPDLRVHQKIHFGEKPYECKECGKAFRICQQLTVHQSIHTGEKPYECKECGKTFRL
RQQLVRHQRIHTREKPYECMECWKTFSSYSQLISHQSIHIGERPYECEECGKAFRLLSQL
TQHQSIHTGEKPYECKECRKPFRLLSQLTQHQSIHTGEKPYECKECGKAFRLYSFLTQHQ
RIHTGEKPYKCKECKKAFRQHSHLTQHQKIHNGI
Download sequence
Identical sequences H2P0J9
9600.ENSPPYP00000011799 ENSPPYP00000011799 ENSPPYP00000011799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]