SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011831 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011831
Domain Number 1 Region: 1-48
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.15e-25
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011831   Gene: ENSPPYG00000010567   Transcript: ENSPPYT00000012287
Sequence length 49
Comment pep:novel chromosome:PPYG2:19_random:5648400:5650548:-1 gene:ENSPPYG00000010567 transcript:ENSPPYT00000012287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPQGLLTFRDVSIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLGE
Download sequence
Identical sequences H2P0N0
ENSPPYP00000011831 ENSPPYP00000011831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]