SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011838 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011838
Domain Number 1 Region: 536-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.36e-26
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 452-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.58e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 24-78
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-22
Family KRAB domain (Kruppel-associated box) 0.00096
Further Details:      
 
Domain Number 4 Region: 368-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.19e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 5 Region: 592-649
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.84e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 648-704
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.86e-19
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 327-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000616
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 499-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000137
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 9 Region: 416-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000749
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 10 Region: 233-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000642
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011838   Gene: ENSPPYG00000010572   Transcript: ENSPPYT00000012294
Sequence length 708
Comment pep:known_by_projection chromosome:PPYG2:19_random:5984497:6002529:1 gene:ENSPPYG00000010572 transcript:ENSPPYT00000012294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPADVNLSQKPQVLGPEEQDGSCEASVSFEDVTVDFSREEWQQLDPAQRRLYQDVMLELY
SHLFSVGYHIPNPDVIFRMLKEKEPRVEEAELSHQRCQEGEFGLEIPQKEISKKASFQKD
MVGEFTRDGSWCSILEELRLDAEHTKKDEQNQIQPMSHSAFFNKKTLNTESNCKYKDPGK
MIHTRPHLASSQKQPQKCCLFTKSLKLNLEVNGQNESNDTEQLDDIVGSGQLFSHSSSDA
CSKNIHTGETFCKGNQCRKVCGHKQSLMQHQIHTQKKPDGCSECGGTFTQKSHLLCTREI
HSVGKPPXXXXXXXXXXXKLSVYLTDHTGDIPCICKECGKVFIQRSEVTHQKTHTRKKPY
KCHDCGKAFFQMLSLFRHQRTHSREKLYECSECGKGFSQNSTLIIHQKIHTGERQYACSE
CGKAFTQKSTLSLHQRIHSGQKSYVCIECGQAFIQKAHLIVHQRSHTGEKPYQCHNCGKS
FISKSQLDIHHRIHTGEKPYECSDCGKTFTQKSHLNIHQKIHTGERHHVCSECGKAFNQK
SILSMHQRIHTGEKPYKCSECGKAFTSKSQFKEHQRIHTGEKPYVCTECGKAFNGRSNFH
KHQITHTRERPFVCYKCGKAFVQKSELITHQRTHMGEKPYECLDCGKSFSKKPQLKVHQR
IHTGERPYVCSECGKAFNNRSNFNKHQTTHTRDKSYKCSYSVKGFTKQ
Download sequence
Identical sequences H2P0N6
ENSPPYP00000011838 ENSPPYP00000011838 9600.ENSPPYP00000011838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]