SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011848 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011848
Domain Number 1 Region: 134-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.09e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 302-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.39e-25
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 3 Region: 218-275
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 344-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-17
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 78-135
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-16
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 6 Region: 265-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000413
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 181-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000473
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 386-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000328
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011848   Gene: ENSPPYG00000010582   Transcript: ENSPPYT00000012307
Sequence length 423
Comment pep:known_by_projection chromosome:PPYG2:19_random:6496155:6518661:-1 gene:ENSPPYG00000010582 transcript:ENSPPYT00000012307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISSHYIEDFLPEQGMKDSFQKVILRRYASCGLEDLHLRKDGENVGEYKDQKKSYNGLNQ
CLSTLPSKIFPYNKCVKVFSKSSNLNRQNIRHTTEKLFKCIQCGKVFKSHSGLSYHKIIH
TEEKLCICEECGKTFKWFSYLTKHKRIHTGEKPYKCEECGKAFNWCSSLTKHKRIHTGEK
PYKCEECGKAFHWCSPFVRHKKIHTGEKPYTCEECGKAFNRHSHLTKHKTIHTGKKPYKC
KECGKAFNHCSLLTVHERTHTGEKPYKCEECGKAFNSSSVLTEHKVIHSREKPYKCEKCD
KVFKRFSYLTKHKRIHTGEKPYKCEECGKAFNWSSILTEHKRIHTGEKPYNCEECGKAFN
RCSHLTRHKKIHTAVKRYKCEECGKAFKRCSHLNEHKRVQRGEKSCKYKKCGEAFNHCSN
FTT
Download sequence
Identical sequences H2P0P5
ENSPPYP00000011848 ENSPPYP00000011848 9600.ENSPPYP00000011848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]