SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011858 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011858
Domain Number 1 Region: 303-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 1-46
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.22e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 415-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 4 Region: 247-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 359-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.81e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 6 Region: 460-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.99e-18
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 7 Region: 192-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.86e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011858   Gene: ENSPPYG00000010592   Transcript: ENSPPYT00000012319
Sequence length 520
Comment pep:known_by_projection chromosome:PPYG2:19_random:7427867:7434898:-1 gene:ENSPPYG00000010592 transcript:ENSPPYT00000012319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCTMKEFSSTAQG
NREVFHAGTLQRHESHHIGDFCFQDIDKDIHDVEFQWQEDERNGHEAPMTKIKKFTGSTD
RYDQNYAGNKPIKYQLGFSFHSHLPELHIFHTEEKIDNQVEKSINHASSVSTAQRISCRP
ETHISNNYGNNFLNSSLLTQKQEVHMREKSFQCNDSGKAYNYSSLLRKHQLIHLGKKQYK
CDVCGKVFNSKRYVARHRRCHTGEKPYKCNECGKTFSQTYYLTCHRRLHTGEKPYKCEEC
DKAFHFKSKLQIHRRIHTGEKPYKCNECGKTFSQKSYLTCHRRLHTGEKPYKCNECGKTF
SRKSHFTCHHRLHTGEKPYKCNECGKTFSHKSSLTYHHRLHTEEKPYKSNECGKTFNQQL
TLKCHCRLHSGEKPYKCEECDKAYSFKSNLEIHQKIHTEENPYKCNECGKTFSWTSSLTY
RHRLHTGQKPYKCEDCDEAFSFKSNLERHRRIYTGEKLHV
Download sequence
Identical sequences H2P0Q4
9600.ENSPPYP00000011858 ENSPPYP00000011858 ENSPPYP00000011858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]