SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011978 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011978
Domain Number 1 Region: 175-215
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000602
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011978   Gene: ENSPPYG00000010713   Transcript: ENSPPYT00000012449
Sequence length 418
Comment pep:known_by_projection chromosome:PPYG2:20:8026946:8057729:1 gene:ENSPPYG00000010713 transcript:ENSPPYT00000012449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NNLNVGSDTTSETSFSLSKEAPGEHLDHQAAHQPFPRPRFRQETGHPSLQRDGPRSFLLD
LPNFPDLSKADINGQNPNIQVTIEVVDGPDSEADKDQHPENKPSWSVPSPDWRAWWQRSL
SLARANSGDQDYKYDSTSDDSNFLNPPRGWDRTAPGHRTFETKDQPEYDSTDGEGDWSLW
SVCSVTCGNGNQKRTRSCGYACTATESRTCDRPNCPGIEDTFRTAATEVSLLAGSEEFNA
TKLFEVDTDSCERWMSCKSEFLKKYMHKVMNDLPSCPCSYPTEVAYSTADIFDRIKRKDF
RWKDASGPKEKLEIYKPTARYCIRSMLSLESTTLAAQHCCYGDNMQLITRGKGAGTPNLI
STEFSAELHYKVDVLPWIICKGDWSRYNEARPPNNGQKCTESPSDEDYIKQFQEAREY
Download sequence
Identical sequences H2P121
ENSPPYP00000011978 ENSPPYP00000011978 9600.ENSPPYP00000011978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]