SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000011989 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000011989
Domain Number 1 Region: 113-459
Classification Level Classification E-value
Superfamily Subtilisin-like 1.09e-81
Family Subtilases 0.00000000865
Further Details:      
 
Domain Number 2 Region: 453-599
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.35e-43
Family Proprotein convertase P-domain 0.0001
Further Details:      
 
Domain Number 3 Region: 30-101
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 7.99e-16
Family Prohormone convertase 1 pro-domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000011989   Gene: ENSPPYG00000010725   Transcript: ENSPPYT00000012461
Sequence length 638
Comment pep:known chromosome:PPYG2:20:12204616:12485845:1 gene:ENSPPYG00000010725 transcript:ENSPPYT00000012461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGGCVSQWKAAAGFLFCVMVFASAERPVFTNHFLVELHKGGEDEARQVAAEHGFGVRKL
PFAEGLYHFYHNGLAKAKRRRSLHHKQQLERDPRVKMALQQEGFDRKKRGYRDINEIDIN
MNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLHPDLASN
YNAEASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSKVAGIRM
LDQPFMTDIIEASSISHMPQLIDIYSASWGPTDNGKTVDGPRELTLQAMADGVNKGRGGK
GSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLASTFSNGRK
RNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLGLTWRDMQHLTVLTSKRN
QLHDEVHQWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSVQDPEKIP
STGKLVLTLTTDACEGKENFVRYLEHVQAVITVNATRRGDLNINMTSPMGTKSILLSRRP
RDDDSKVGFDKWPFMTTHTWGEDARGTWTLELGFVGSAPQKGVLKEWTLMLHGTQSAPYI
DQVVRDYQSKLAMSKKEELEEELDEAVERSLKSILNKN
Download sequence
Identical sequences A0A2J8VD76 G3QWE4 Q5REC2
9600.ENSPPYP00000011989 ENSPPYP00000011989 ENSGGOP00000007101 NP_001124879.1.23681 XP_004061882.1.27298 XP_011834856.1.47321 ENSPPYP00000011989 ENSGGOP00000007101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]